KEGG   Synechococcus sp. CC9902: Syncc9902_0896Help
Entry
Syncc9902_0896    CDS       T00293                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syncc9902_0896
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syncc9902_0896
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Syncc9902_0896
Enzymes [BR:sye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Syncc9902_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
891515..892324
Genome map
AA seq 269 aa AA seqDB search
MSSQQSSSIALRFEQLKREGRMALMPFLMAGDPDLSVTAEVLLSLQAAGADMVELGMPYS
DPLADGPVIQAAAARALAAGTTPKKVLEMLSSLRGQLSIPVILFTYSNPLLNVGMERFCE
QAAEAGASGLVVPDLPLEEAERLSPIAEREGLDLVLLVAPTTPTERMGRIAQSSRGFTYL
VSVTGVTGERSTMETRVEGLVQALKQSSPVPVAVGFGISGVDQVRQVRSWGADGAIVGSA
LVKRMASASLGSVAAEAGLFCSELRKAAD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtcagcagtcatcgtccatagcgctgcgttttgaacaactgaagcgagaaggt
cgcatggccctcatgccatttctgatggccggtgatcctgatttatccgtcaccgcggag
gtgttgctcagcctccaagccgcaggtgccgacatggtggagcttgggatgccctacagc
gatccgctggcggatggacctgtgatccaagctgctgctgcacgagcattagcggctggt
acgacaccgaaaaaagttttggagatgttgtcgtccctccgaggtcagctgtcgatcccc
gtgattttgttcacttattccaatccccttctcaacgtggggatggagcgtttttgcgag
caagcagcagaagccggcgcctccgggttagtggttccggatcttcctttggaggaagct
gaacggttgtctccgattgcggagcgggaagggctggaccttgtccttttggtggcaccg
accaccccaacagagcggatggggcggatcgctcaaagcagtcggggattcacctattta
gtcagtgtgactggggtgactggggaacgcagcacgatggagactcgtgtcgaggggttg
gttcaagctctgaagcaatcatcccctgtacccgttgccgtcggatttgggatttctgga
gtcgatcaggtacgacaggtgcgcagttggggtgctgatggagcgattgtgggaagtgct
ttggtgaaacgaatggcgtccgcatcattgggttctgtggcggcggaagcaggattgttt
tgctctgaactccgcaaggcggcagattaa

DBGET integrated database retrieval system