KEGG   Synechococcus sp. CC9902: Syncc9902_0919Help
Entry
Syncc9902_0919    CDS       T00293                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sye  Synechococcus sp. CC9902
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Syncc9902_0919
Enzymes [BR:sye01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Syncc9902_0919
Exosome [BR:sye04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Syncc9902_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(906292..908586)
Genome map
AA seq 764 aa AA seqDB search
MGGAAVLDWMVQDGVRLENCRHDHPLAVLGPQPDDQGWTVRVWMPEAQKVTLLLGSQEIV
TSTPNHPWIFEASTPSDPGSNYKLRVERGGITTEQHDPWAFRHEWMGEMDRHLFAEGNHH
HIWQRMGAHLTQIDGISGVMFCLWAPNALTASVLGDLNSWDGRHHPMQKRLGGIWELFVP
GLDAGTLYKYEIRSQEGHCYQKADPYGFQHEVRPDNSSVVARLEGYSWSDSSWMQDRDSR
NALDQPISVYEMHIGSWIHASADEPWIQPDGQPRAPVPAADMKPGARLLTYAELSDRLIP
YVKERGFTHIELMPITEHPFDGSWGYQVTGWYAPTSRYGTPDEFRAFVDRCHAEGIGVII
DWVPGHFPKDAHGLAFFDGTHLYEHGDPRIGEHKEWGTLIFNYSRNEVRNFLVANLVFWF
EQFHIDGIRVDAVASMLYRDYLRPDGEWLPNENGGRENTEAVRFLQQANHVLFQHYPGAL
SIAEESTTWPMVTQPTDMGGLGFNLKWNMGWMHDMLDYFELDPWFRQFHQNNITFSIWYT
YTENFMLALSHDEVVHGKSHLLHKMPGDDWQKYANTRALLAYMWTHPGKKTIFMGMEFGQ
RAEWNVWGDLEWDLLNYEPHKGIQRLVDDLNVLYKAQPALWRDDFDQFGFQWIDCNDNRH
SVISFMRRDSASGTWLVVVANFTPQSHANYRVGVPLEGFYEEIFNTDAAKYGGSNLGNMG
GKPTDACGIHGYEHSLDLCLPPLSLVVFQHDPKRTLIESSAPSD
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcgctgcggtcctcgactggatggttcaggacggcgtacggctagaaaattgc
cgtcacgaccacccccttgcggtgctgggacctcagcccgatgaccaaggatggaccgtg
cgggtttggatgcccgaggctcaaaaggtaaccctcctgctgggcagtcaggagatcgtt
acatccacaccaaaccatccatggatttttgaggcttcgacaccctcagacccgggcagc
aactacaagctgagggttgagcgtggagggatcaccaccgaacaacatgatccttgggcc
ttccgccacgaatggatgggagagatggatcgccatctttttgcagaagggaatcatcac
cacatctggcagcggatgggtgcacatctcacccagatcgatggcattagtggggtgatg
ttctgcctttgggctccgaacgctctaactgcttccgtccttggcgatctcaactcttgg
gatggtcgccatcatccgatgcaaaaacggctcggaggaatctgggaattgttcgtcccc
ggactagacgcaggaactctctacaaatacgaaattcgctcccaggaagggcactgctac
caaaaagctgatccctacggttttcaacacgaggttcgtcccgacaacagttccgttgtg
gcacggcttgagggatacagctggtccgactccagctggatgcaggatcgagacagtcgg
aatgctctcgaccaaccgatctctgtgtatgagatgcacatcggaagctggattcatgct
tctgctgacgagccttggatccaaccggatggccaaccgcgggcacccgttcccgcggcg
gatatgaagccaggcgctcgactcctgacctacgccgagttatcggatcgccttatccct
tatgtgaaagaacgaggcttcacccacatcgaattgatgccgatcaccgagcatcccttt
gatggatcttggggctaccaagtaaccgggtggtatgcccccaccagccgttacggcacc
cctgacgaattccgtgcctttgtcgatcgctgtcacgctgaaggaatcggcgtgatcatc
gattgggtccctggacacttccccaaagatgcccatggattggccttctttgatggaacc
catctctatgagcatggtgatccacgcatcggtgaacacaaagagtggggaacactgatt
ttcaactacagccgaaatgaagttcgcaactttcttgttgccaacctcgttttttggttt
gaacagtttcacatcgatggaattcgagtcgatgctgttgcctccatgctttaccgggat
tatttgaggcccgatggggaatggctaccaaatgaaaatggtggtcgcgaaaatactgag
gctgttcgtttcctccaacaagccaatcatgtgctgttccagcactacccaggtgccctt
tcgattgcagaagaatcgaccacctggccgatggtgacccaacccactgacatgggcgga
cttggattcaacctcaaatggaacatgggttggatgcacgacatgctcgactatttcgag
ctggacccttggttccgtcagttccaccaaaacaacatcaccttctctatttggtacacc
tatacggagaacttcatgttggccctgagtcacgatgaagttgtccatgggaagagtcat
cttcttcacaagatgcccggtgatgattggcagaagtacgccaacacaagggctcttttg
gcctacatgtggacacatccaggcaagaaaaccatcttcatggggatggaatttggccaa
agggctgaatggaatgtttggggagatctcgaatgggatctgctcaattacgagccgcac
aagggaattcaacgcctggttgatgatctgaatgtgctgtacaaggcccaaccagcccta
tggcgcgatgattttgatcagtttggtttccagtggattgattgcaacgacaatcgccac
tccgttatcagcttcatgagacgcgatagcgccagtggaacctggcttgttgtggtggcc
aacttcacaccacagagccatgccaactaccgcgtcggcgttccgcttgagggcttctac
gaagagatcttcaataccgatgctgccaaatacggcggcagcaacctcgggaacatgggt
ggcaagcccacagacgcttgcggcattcacggctatgagcactccttggatctctgcctg
ccaccactgagcttggtggtgtttcagcacgatccaaagcgcacgctgatcgaatcctcc
gcgccatccgactaa

DBGET integrated database retrieval system