KEGG   Synechococcus sp. CC9902: Syncc9902_0926Help
Entry
Syncc9902_0926    CDS       T00293                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9902_0926
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0926
   00052 Galactose metabolism
    Syncc9902_0926
   00500 Starch and sucrose metabolism
    Syncc9902_0926
   00520 Amino sugar and nucleotide sugar metabolism
    Syncc9902_0926
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Syncc9902_0926
   00524 Butirosin and neomycin biosynthesis
    Syncc9902_0926
Enzymes [BR:sye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Syncc9902_0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
916630..917523
Genome map
AA seq 297 aa AA seqDB search
MSSDQVIGIDLGGTAIKLARFNRAGDVLAELQIPTPQPPVPGAVTMALCEAIEQLDPDHL
AALVGVGLPGPMDAKARVARVCINLSGWDDVPLADWLEPRLQRQVTLANDGNCAVVGEAW
LGAAKGFEDVVLLTLGTGVGGGVLLGGALFTGHNGAAAEPGLIGVQPDGPPCNSGNRGSL
EQFASIAALRRLCDVDPEVLSTRADAGDLEAKAIWQQYGTTLGIGIASLVYVFTPQRVLL
GGGLAAAATHFLPAVRHEVEARVQAVSREGLSIEPCALGNGAGRLGAARLALQRLGG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgatcaggtgatcggtatcgatctgggtggtacggcgatcaagttggcgcgt
ttcaatcgcgctggagacgtcctggcagaactgcagattccgacgccccaacccccagtg
cctggggcggtaacgatggccttgtgcgaagcgatcgaacagctggatccagatcatctc
gccgctcttgtcggtgttggtttgccgggtccaatggacgcgaaggcacgggtcgcgcgc
gtttgcatcaacctttctggctgggacgacgtccccctagcggattggttggaacctcgc
ttgcaacgtcaagtcaccctcgcgaatgacggaaactgtgccgtggttggagaagcctgg
ctgggggccgctaaagggttcgaggatgtggtgttgctcacccttggtacgggcgttggg
ggaggcgtgcttttgggtggtgcgttattcacgggccataacggtgctgcggctgagccc
ggtttgataggtgttcagccggatggcccgccttgcaacagtggcaatcggggatccttg
gagcagttcgccagcattgccgcgttgcgacgtctttgtgatgtcgatcccgaggtgttg
agcacgagagctgacgcgggtgatcttgaagcaaaggccatctggcagcagtacggaacc
acccttggcattgggatcgcgtcgttggtttatgtgttcacccctcagcgcgtgcttctc
ggcggtggtttggcagctgcggcaactcacttccttcctgccgttcgtcatgaggtggag
gcccgtgttcaggccgtgtcacgggaagggctatccattgagccctgtgctcttggcaat
ggtgctgggcgtcttggcgctgctcgtttggcgttgcagcgtcttggtggctga

DBGET integrated database retrieval system