KEGG   Synechococcus sp. CC9902: Syncc9902_0933Help
Entry
Syncc9902_0933    CDS       T00293                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9902_0933
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0933
   00052 Galactose metabolism
    Syncc9902_0933
   00500 Starch and sucrose metabolism
    Syncc9902_0933
   00520 Amino sugar and nucleotide sugar metabolism
    Syncc9902_0933
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Syncc9902_0933
   00524 Butirosin and neomycin biosynthesis
    Syncc9902_0933
Enzymes [BR:sye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Syncc9902_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(924548..925621)
Genome map
AA seq 357 aa AA seqDB search
MYSGWSEFLQTSCMAFSTLLAGDMGGTKTLLALYGIQDGRLTQLYQQRFMSSEWTSLEPM
LKFFLNKRPSDIEAPEHGCIAVAGPVNNGSARITNLPWQLNEDQLAVAASIRQLELVNDF
GVLIYGLAHFDETQQVVLQIGEAQAGPVAILGAGTGLGMARGIRTEGGVVALSSEGGHRE
FAPRTEEEWQLACWLKHDLAIDRLSVERIVSGTGLGHIATWLLQKPDTQQHPLQPVAQEW
RTNKSCDLPAKVGMAAEQGDPLMQRAQTIWLSAYGSAAGDLALQELCTGGLWIGGGTATK
QIAGLQSATFLEAMRQKGRFKEFLAGLRVTAVIDPEAGLFSAACRARILAESSGTLS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtattcaggctggagtgaattcctccagacctcttgcatggccttctcaacactgttg
gccggtgatatgggaggaaccaaaactctcctggccctttacggaatccaggacggtcgg
ctcacgcagctttaccagcagcgatttatgtccagcgaatggacgtcgctggaaccgatg
ctgaaattctttttaaacaagcgacctagcgacatcgaagcgcctgaacacggatgtatt
gctgtcgccggaccggtgaacaacggcagtgctcgcattacaaaccttccttggcaatta
aacgaagaccaactggccgttgcagcatcgatacgccaactcgaactcgttaacgatttc
ggcgtcttgatttatggactagcgcacttcgacgaaacccagcaagttgtcctccaaatc
ggggaagcacaggcaggtccggttgccattcttggcgctggaacgggcttaggcatggct
cggggaatccggactgaaggtggagtggtcgccctttcaagtgaaggggggcatcgagaa
ttcgccccacgaaccgaagaggaatggcaattggcctgctggttgaaacacgatctagcc
attgatcgtttgtcggtggaacgcatcgttagcggaactggactaggacatatcgcgacg
tggttgctccagaagcccgacacccaacaacaccccctgcaaccagtcgcccaggaatgg
agaaccaataagtcctgtgatttgccggccaaagtgggcatggcagcagaacaaggtgac
ccattaatgcaacgggcccaaacgatttggttgtctgcctatgggtcagcggcgggggac
cttgcactccaggaactctgcacaggagggctttggatcggtggaggaacggcgaccaaa
caaatcgcaggattgcagtcagcaaccttcctcgaggccatgcgtcaaaagggtcgcttt
aaagagttcttggcaggtttaagggtcaccgcggtcatcgaccctgaagcaggtctcttc
agtgcagcgtgtcgggcaagaatcttggctgagtcaagtgggacactgtcctga

DBGET integrated database retrieval system