KEGG   Synechococcus sp. CC9902: Syncc9902_1298Help
Entry
Syncc9902_1298    CDS       T00293                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sye  Synechococcus sp. CC9902
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sye00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syncc9902_1298 (ruvA)
Enzymes [BR:sye01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Syncc9902_1298 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1254908..1255552
Genome map
AA seq 214 aa AA seqDB search
MIGWLQGRHMECWTQGNRSGVLLVCAGVGYEVQLTSRHQKQLQPDSELTLWIHQVQREDG
SSLFGFPSRQERDLFRLLIGVNGVGPQAGLALLHECKPQELVAAISGGDLKRLCQAQGIG
KRTAERLAVDLRTPIAAFGGLEPQPSLVEGLASEQIPEAGEDVEATLISLGYDELEIRRA
IRAIADGASGVPPSGTDQDGWLRSCLQWLSRESA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatcggctggctgcaaggacggcacatggagtgctggacccaggggaatcgcagcgga
gtgctgctggtgtgtgcgggggtgggctatgaggtgcaactcacctcacgccatcaaaaa
caactccagcctgacagtgaactcaccctttggatccaccaagtgcaacgggaggatggc
agcagtttatttggcttcccctctcgccaagaacgggacctgtttcgccttctgatcggc
gtcaatggcgttgggccccaagccggtttagcccttctccatgaatgcaagccacaagaa
ttggtcgcagcgattagcggtggagacctcaaacggctttgccaagcccagggcatcggc
aaacgcacggccgagcgtctcgccgtcgacctgcgcaccccgatcgcggcattcggcgga
ctcgagccccaaccatccctcgtggagggactggcatccgagcaaatccccgaagcggga
gaggacgttgaggcaacgctgatcagcctgggctacgacgaactcgaaattcgccgcgcc
atacgcgctattgccgatggagccagtggtgtgccgccctcaggcaccgatcaagacggt
tggctacggagctgtcttcaatggctgagcagggaatccgcttaa

DBGET integrated database retrieval system