KEGG   Synechococcus sp. CC9902: Syncc9902_1318Help
Entry
Syncc9902_1318    CDS       T00293                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00010  Glycolysis / Gluconeogenesis
sye00620  Pyruvate metabolism
sye00640  Propanoate metabolism
sye00680  Methane metabolism
sye01100  Metabolic pathways
sye01110  Biosynthesis of secondary metabolites
sye01120  Microbial metabolism in diverse environments
sye01130  Biosynthesis of antibiotics
sye01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_1318
   00620 Pyruvate metabolism
    Syncc9902_1318
   00640 Propanoate metabolism
    Syncc9902_1318
  Energy metabolism
   00680 Methane metabolism
    Syncc9902_1318
Enzymes [BR:sye01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Syncc9902_1318
Lipid biosynthesis proteins [BR:sye01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Syncc9902_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABB26282
JGI: Syncc9902_1318
CyanoBase: Syncc9902_1318
CYORF: Syncc9902_1318
UniProt: Q3AXC5
Position
complement(1274375..1276396)
Genome map
AA seq 673 aa AA seqDB search
MDLLLTLSDKRLVQPSLTNTNTSIESVLQEQRVFEPPASFSAEASISSLEAYRAMADAAK
ADPDSFWGDAARRELHWFEPFHTVLDWSDAPFARWFEGGTTNLSFNCLDRHLEGPTADKT
ALIWEGEPGDVRRFTYRELHAEVCKAANALKAMGLGKGDLVALYMPMIPEAAIAMLACAR
IGAPHSVVFGGFSAEALRDRLIDGEVKAVITADGGFRKDKPVSLKPAVDAALADGACPTV
HSVLVVQRTKQDVTMVEGRDQWWHDLVSGQSDACVAEPMASEDRLFVLYTSGSTGKPKGV
VHTTAGYNLWAHLTFQWIFDCRDDDVFWCTADVGWITGHSYIVYGPLSNGATTVMYEGAP
RPSKPGAFWELIQKHGITIFYTAPTAIRAFMKGGRSVPDQFDMSSLRLLGTVGEPINPEA
WMWYRDVIGGNRCPIVDTWWQTETGGVMISPLPGATPTKPGSATLPLPGIQADIIDAEGN
SCGDDEGGYLAVRAPWPGMMRTVHGNPQRFRESYWEHIRPADGSYLYFAGDGARRDADGY
FWVMGRVDDVINVSGHRLGTMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFVTLETGR
EGTAELQAELRKHVGTEIGPIARPDEIRCSDALPKTRSGKIMRRILRALAAGEEVTGDTS
TLEDRSVLDRLRA
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggatctgctccttaccctgagcgataagcgcctcgttcagccttccttgacgaacacc
aacacatcgatcgaaagcgtgctgcaggagcagcgtgtgttcgaacctcccgcgagcttt
tctgcagaggcttcgattagcagccttgaggcttacagggccatggccgatgcggcgaag
gctgatccggacagcttttggggagacgccgcccgtcgcgaactgcattggtttgagcca
tttcatacagttctggattggagcgatgcccccttcgcccgctggtttgaggggggcacc
accaacttgtcgttcaactgcctcgatcggcatcttgagggccctacggccgacaagaca
gcgctgatctgggagggagagcctggtgatgtgcgtcgcttcacctatcgcgaactgcat
gccgaggtctgtaaggctgccaatgccctgaaggccatgggcctcggcaagggcgacttg
gtggcgctttacatgccgatgatcccggaagcggcgattgcgatgctcgcttgtgcccgt
attggggcgccccattccgtggtgtttggaggcttctcggccgaagcgttgcgggatcgg
ttgattgatggcgaggtgaaggcggtgatcaccgccgatggcggcttccgaaaagacaaa
cctgtttcgctgaagccagccgtcgatgctgccctggccgatggggcctgcccaaccgtt
cactccgtgttggtggttcagcgcaccaagcaggacgtgacgatggtcgaggggcgcgac
cagtggtggcatgacttggtgtcgggccaaagcgacgcctgtgtggctgaaccgatggca
agtgaagaccgcttatttgttctctacacctctggttccacaggaaaacccaagggtgtg
gtgcacaccacggctggatacaacctttgggcgcatctcaccttccaatggatttttgat
tgtcgcgacgacgacgtgttttggtgcacagccgatgtgggctggattacagggcacagc
tacatcgtttacggccccctttccaatggagctacaacggtgatgtatgagggcgcccca
cgtccctcgaaaccaggggcgttctgggagttgattcagaagcacggcatcacgatcttt
tacaccgcaccaacggcgattcgggcctttatgaagggcggacgttcggtgcccgatcag
ttcgatatgtccagtcttcgtttactgggcactgtcggggagccgatcaatccagaagct
tggatgtggtatcgcgacgtgattggtggaaaccgttgtccgatcgtcgatacctggtgg
caaaccgaaaccggtggagtgatgatcagccccttgcctggggcaacgccaaccaaacca
ggttcagcgaccttgcccttgcctggaattcaggccgacatcattgatgctgagggcaac
agttgtggcgatgacgaagggggctatctcgcggtgcgtgctccttggccgggaatgatg
cgcacggtgcatggcaacccccagcgtttccgggagagttattgggagcacatccgtcca
gcggatggctcctatctttatttcgctggcgatggcgctcgccgcgatgccgacggctac
ttctgggtgatgggacgggttgatgacgtcatcaatgtgtccggacatcgcctgggcacg
atggaaatcgaatcagctcttgtaagccatcccgccgttgcagaagctgcggtcgtgggg
cgtccagatgatctcaagggggaaggcatcgtcgccttcgtcaccttggaaacgggtcgg
gaaggcaccgctgaactccaagctgaattgcggaagcatgtcggtacagagatcggaccg
attgcccgtcccgatgaaatccgctgcagtgatgcgcttccaaaaacccgcagtggaaaa
atcatgcgacggattctgcgtgctctcgccgctggcgaagaggtcaccggagacaccagc
accctcgaagatcgctccgtgctcgatcgtctacgggcttaa

DBGET integrated database retrieval system