KEGG   Synechococcus sp. CC9902: Syncc9902_1375Help
Entry
Syncc9902_1375    CDS       T00293                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sye  Synechococcus sp. CC9902
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Syncc9902_1375
Enzymes [BR:sye01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Syncc9902_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1333973..1335529
Genome map
AA seq 518 aa AA seqDB search
MMTEAATQRARTSGVLLHPTALPDSPVCGTFGEPSRRWLHQLANSGIGVWQMLPLSPPDP
TGSPYSSPSCFALNAWLLDASDLANEQFISHEALNGLPGASVTAAEATMLDFQLANQRSN
ALADALLEAWPQQTSEQHEAFRHWCSQQSWLDDHVTFSVLHAQHNNAWWTWPKPLAQHQR
RALKAWAADNQAALMKERLMQWQLDRQWQEIRRLAHDLGVVLFGDLPFYVSTDSADVWSH
RNLFTVKESGELTLQSGVPPDYFSETGQLWGSPVYRWGRHRITRFRWWRNRISRQRELVD
LLRLDHFRALAAFWAVPGGDTTAQNGQWQSSPGHALLARLQKDAGGNLPLIAEDLGVITP
DVEDLRDQFALPGMKVLQFAFDGQSDNPYLPENMDGSRWVVYTGTHDNPTTLGWWQRLDS
NSRERITTRINGEVSAPAWHLFDMAFATPATLVVAPLQDLMHLDDRARFNTPGTCTGNWN
WRLSQFDNTLEGSLKGFGERAKVWGRNLESATALLNHQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaccgaggcagccacccagcgggcccgcacaagcggtgtgttgctccatcccaca
gcactgcccgacagccctgtctgcggaacttttggtgaacccagccgtcgctggctccat
caactggccaacagcggcatcggagtttggcaaatgttgccgctctcaccgccagatccg
actggatccccttacagctccccctcctgctttgccctcaacgcctggttgctcgacgca
tcagatctggcgaatgaacaattcatcagccacgaggccctgaatggcctgcccggagca
tccgtgacagcagccgaggcaacgatgcttgatttccagctggcaaaccaacgcagtaac
gccctggccgatgcactccttgaggcgtggccgcaacagacgtcagaacaacacgaggcc
ttccggcactggtgcagccaacaatcctggctcgacgaccacgtgacgttcagcgttttg
catgcccaacacaacaacgcatggtggacctggccaaagccactggcccagcatcaacgt
cgagcactcaaagcctgggcagcggacaatcaagcagcgctgatgaaagagcgcctgatg
cagtggcagcttgatcgccaatggcaagagatccgacgactggcccacgacctgggcgtg
gtgttgtttggcgatttgcccttttacgtgagcaccgacagcgctgatgtgtggagccat
cgcaacctattcaccgtgaaagaatccggggaactcactcttcagagtggggttcctccg
gattacttttccgaaacggggcaactctgggggtcccccgtctatcgctggggacgacac
cgcatcacccgcttccggtggtggcgaaaccgcatcagccgccaacgggaattagttgat
ctactgcgattggatcattttcgcgccctcgctgccttttgggccgttccagggggggat
acaaccgctcaaaatggtcaatggcaatcatccccaggccatgccttgctggccagattg
cagaaagacgcgggcgggaatttgcctttaattgcagaagaccttggcgtgattacgcca
gatgtggaagacctgcgtgatcaatttgccttgcctggcatgaaagtgcttcagtttgct
tttgatggccaaagcgacaatccctatcttccagaaaacatggatggcagccgctgggtg
gtctacacaggaacccatgacaacccaacaaccctgggctggtggcagcgtctcgatagc
aatagccgagagcgaattacgacacggattaatggcgaagtctctgctcccgcttggcat
ttattcgatatggcatttgcaacaccagccactcttgtggttgcgcccctccaagattta
atgcatctcgacgaccgagcccgattcaatacccctggaacatgcacaggaaattggaat
tggcgcctcagtcagtttgacaacacactggagggatctctgaagggatttggagaacgc
gccaaggtttggggacgaaaccttgagagcgctacagcgctgctaaaccatcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system