KEGG   Synechococcus sp. CC9902: Syncc9902_1375Help
Entry
Syncc9902_1375    CDS       T00293                                 

Definition
(GenBank) Glycoside hydrolase, family 77
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00500  Starch and sucrose metabolism
sye01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Syncc9902_1375
Enzymes [BR:sye01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Syncc9902_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ABB26339
JGI: Syncc9902_1375
CyanoBase: Syncc9902_1375
CYORF: Syncc9902_1375
UniProt: Q3AVD7
Position
1333973..1335529
Genome map
AA seq 518 aa AA seqDB search
MMTEAATQRARTSGVLLHPTALPDSPVCGTFGEPSRRWLHQLANSGIGVWQMLPLSPPDP
TGSPYSSPSCFALNAWLLDASDLANEQFISHEALNGLPGASVTAAEATMLDFQLANQRSN
ALADALLEAWPQQTSEQHEAFRHWCSQQSWLDDHVTFSVLHAQHNNAWWTWPKPLAQHQR
RALKAWAADNQAALMKERLMQWQLDRQWQEIRRLAHDLGVVLFGDLPFYVSTDSADVWSH
RNLFTVKESGELTLQSGVPPDYFSETGQLWGSPVYRWGRHRITRFRWWRNRISRQRELVD
LLRLDHFRALAAFWAVPGGDTTAQNGQWQSSPGHALLARLQKDAGGNLPLIAEDLGVITP
DVEDLRDQFALPGMKVLQFAFDGQSDNPYLPENMDGSRWVVYTGTHDNPTTLGWWQRLDS
NSRERITTRINGEVSAPAWHLFDMAFATPATLVVAPLQDLMHLDDRARFNTPGTCTGNWN
WRLSQFDNTLEGSLKGFGERAKVWGRNLESATALLNHQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaccgaggcagccacccagcgggcccgcacaagcggtgtgttgctccatcccaca
gcactgcccgacagccctgtctgcggaacttttggtgaacccagccgtcgctggctccat
caactggccaacagcggcatcggagtttggcaaatgttgccgctctcaccgccagatccg
actggatccccttacagctccccctcctgctttgccctcaacgcctggttgctcgacgca
tcagatctggcgaatgaacaattcatcagccacgaggccctgaatggcctgcccggagca
tccgtgacagcagccgaggcaacgatgcttgatttccagctggcaaaccaacgcagtaac
gccctggccgatgcactccttgaggcgtggccgcaacagacgtcagaacaacacgaggcc
ttccggcactggtgcagccaacaatcctggctcgacgaccacgtgacgttcagcgttttg
catgcccaacacaacaacgcatggtggacctggccaaagccactggcccagcatcaacgt
cgagcactcaaagcctgggcagcggacaatcaagcagcgctgatgaaagagcgcctgatg
cagtggcagcttgatcgccaatggcaagagatccgacgactggcccacgacctgggcgtg
gtgttgtttggcgatttgcccttttacgtgagcaccgacagcgctgatgtgtggagccat
cgcaacctattcaccgtgaaagaatccggggaactcactcttcagagtggggttcctccg
gattacttttccgaaacggggcaactctgggggtcccccgtctatcgctggggacgacac
cgcatcacccgcttccggtggtggcgaaaccgcatcagccgccaacgggaattagttgat
ctactgcgattggatcattttcgcgccctcgctgccttttgggccgttccagggggggat
acaaccgctcaaaatggtcaatggcaatcatccccaggccatgccttgctggccagattg
cagaaagacgcgggcgggaatttgcctttaattgcagaagaccttggcgtgattacgcca
gatgtggaagacctgcgtgatcaatttgccttgcctggcatgaaagtgcttcagtttgct
tttgatggccaaagcgacaatccctatcttccagaaaacatggatggcagccgctgggtg
gtctacacaggaacccatgacaacccaacaaccctgggctggtggcagcgtctcgatagc
aatagccgagagcgaattacgacacggattaatggcgaagtctctgctcccgcttggcat
ttattcgatatggcatttgcaacaccagccactcttgtggttgcgcccctccaagattta
atgcatctcgacgaccgagcccgattcaatacccctggaacatgcacaggaaattggaat
tggcgcctcagtcagtttgacaacacactggagggatctctgaagggatttggagaacgc
gccaaggtttggggacgaaaccttgagagcgctacagcgctgctaaaccatcaataa

DBGET integrated database retrieval system