KEGG   Synechococcus sp. CC9902: Syncc9902_1399Help
Entry
Syncc9902_1399    CDS       T00293                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sye  Synechococcus sp. CC9902
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sye00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syncc9902_1399 (recR)
DNA repair and recombination proteins [BR:sye03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Syncc9902_1399 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1363708..1364286)
Genome map
AA seq 192 aa AA seqDB search
MARLIDQFQRLPGIGPRTAQRLALHLLNQPEDQVQQFADALLAARSQVGQCQSCFHLSAD
PLCEICSKPERNNGLICVVADSRDLLALERTREFKGQYHVLGGLISPMDGIGPELLHIKP
LIERIAKDGISEVILALTPSVEGDTTSLYLARLMKPFCPVSRIAYGLPMGSELEYADEVT
LSRALEGRRPMD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcggctgattgatcagtttcagcgtttgcctggtattggcccgcgcacggcgcaa
cgccttgccctgcatttgctcaaccagcccgaagatcaggttcagcaatttgcagacgct
ttgttggcggcccgctctcaagttggccagtgccagagctgttttcacctctctgccgat
cccctctgtgagatttgcagcaaaccggaacgtaacaacggtttgatttgtgttgtggct
gattcgcgggatttattggccttggaacgcacgcgggagttcaaggggcaatatcacgtg
ctcggtggtttgatttctccgatggatggcatcggcccggagttgttgcatatcaagccc
ttgatcgagcgcatcgctaaggatgggatcagtgaagtgatcttggcgctgacgcccagc
gttgaaggagacaccacaagtttgtatctggcacggttgatgaagcccttttgccccgtt
agccggatcgcctatggcttgccgatggggagcgaactcgaatacgccgatgaggtcacc
ctcagcagggccctcgaaggccgccgcccgatggattga

DBGET integrated database retrieval system