KEGG   Synechococcus sp. CC9902: Syncc9902_1414Help
Entry
Syncc9902_1414    CDS       T00293                                 

Definition
pyridoxine 5'-phosphate synthase
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
sye  Synechococcus sp. CC9902
Pathway
Vitamin B6 metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:sye00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1381973..1382722)
Genome map
AA seq 249 aa AA seqDB search
MASLGVNIDHIANIREARRTVEPDPVPMAMLAELGGADGITVHLREDRRHIQDRDVELLR
QTVRSRLNLEMAATAEMVAIALRVKPDMVTLVPEHRQEVTTEGGLDVVAQLSELTGMVSQ
LQTSGIPVSLFVDPVASQLRGCTDSGARWVELHTGRYAEGSWNDQPHELARLTEGTATAR
AMGLRVNAGHGLTYQNVEPVAAIPGMEELNIGHTIVARAVVVGLQQAVREMKALIQNPRR
DPLFGQALG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttgggcgtcaatatcgatcacattgccaacattcgcgaagcgcgacgcacg
gtcgaacctgatcccgtgccgatggcgatgctcgctgaattggggggtgctgatgggatc
acagtccatctcagagaagatcgtcgtcacatccaagatcgcgatgttgaactgttgcgg
cagaccgttcggtctcgactgaatttggagatggctgcaacggccgagatggtggccatt
gctttgagggtgaagcccgacatggtgacgctggtgccagaacatcgccaagaggtaacc
acggagggtggcctggatgtggtggcgcagttgtcggaactcactggaatggtgagccag
cttcagaccagcggaattccggtgagcttgtttgtggatcccgtggcttctcagctacga
ggctgcactgattccggggcgcgttgggtggaactccacaccgggcgttatgcggagggc
agttggaatgatcaaccccacgaattagctcgactcaccgagggcaccgctacggctcgg
gccatgggcctgcgtgtcaatgcaggtcatgggctcacgtatcagaacgtggagcctgtg
gccgcgatccccggaatggaagaactgaacattggccatacgatcgtcgctcgtgcagtt
gtcgttggactgcaacaggcggtgcgagaaatgaaggcgttgattcagaatcctcggcgt
gaccccttgtttggacaggcactcggatga

DBGET integrated database retrieval system