KEGG   Synechococcus sp. CC9902: Syncc9902_1489Help
Entry
Syncc9902_1489    CDS       T00293                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sye  Synechococcus sp. CC9902
Pathway
Other glycan degradation
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sye00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1440723..1443194)
Genome map
AA seq 823 aa AA seqDB search
MRGMLRRGSSPWTPPLASWSRPFGLGWDQPYSVRYASNLDDGPNHGMPLGGLGAGCFGRA
PDGNTNLWHLDGGEHWFGTLPDCQFSLWEKQGDDVRAHALAVAPEGDASRPDAAASLPAW
SWYPASTNKRCTGTYAARYPLSWTHYDGVFRSGVLCEAFSPILPGDYQRSSYPVAVFCWQ
LANPTDQPLELSLMVSWRNTVGWFTNTDASAEVHFRDDGSPEHNYSPAIGRGAGQRNRAH
SESGLTGVLMEGRSSEPIQEGEGQWCLAVPDDLAGVEVLRCSRWDPSGDGSDIWTPFSAE
GRIPESDNDRESRAGEQASAAMVVKFILAPGESREIPVVISWDLPITAFASGCADRRRYT
DFFGSDGRNAAAIAAEALRDWSDWRGRIEAWQQPVLERKALPEPVRMALFNELYDLCSGG
SLWTAATAQDPYGRFGVLECLDYAWYESLDVRLYGSLALLQLWPELDKAVLRSFSRAIPA
HDATQRPIGWYFTQGRGRVEADRKVAGATPHDLGAPNELPFDATNYTAYQDCNLWKDLAS
DFVLQVWRTFQLAPTGEDLNFLADCWPSAVRALDYLKGFDVNDDGLPDNGGAPDQTFDDW
PLKGVSAYCGALWIAALEAALAMAQRLQLDLGLDTTVEQRRFGQWLEQSRSNFDRLLWNG
EYYEIDAESGTPVVMADQLCGDFYARLLGLPSVVSDANALSTLNVVRDACFERFEGGTLG
VANGLRRDGTPLDPNGTHPLEVWTGINFGIASYFRLMGQSDTALAITGAVVNQVYSGGLQ
FRTPEAITAVNTFRACHYLRAMAIWGLWATDTDWAEIPGASER
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgggatgcttcgccgtggttccagtccttggaccccgccattagcgagttggagc
cgaccgtttggcctcggttgggaccagccctacagcgtccgttatgcgagcaatctcgat
gatggtccgaaccacggcatgccgctggggggattaggtgctggatgcttcggccgcgcc
cccgatggcaacaccaatctgtggcaccttgatggtggggaacattggtttggaacgctc
cccgattgccagttctctctttgggaaaagcagggtgatgatgtgcgcgcccatgccctt
gccgttgcgccggagggtgatgcgtcgcgtccagatgctgcggcatcgcttccggcttgg
agttggtaccccgctagtacgaacaaacgctgtacaggcacctatgccgcccgatatccg
ctgagttggacccactacgacggggtgtttcgttccggggtgctgtgtgaagcgttcagc
ccgattcttccgggcgattaccaacgcagcagttatccggtagcggtgttttgttggcag
cttgcgaaccccaccgatcaaccgttggagttgtcgttgatggtgagttggcgcaacacc
gttggctggttcaccaataccgatgcttcagcggaagttcacttccgtgatgacggaagc
cctgaacacaactattccccagccattggccgtggcgcagggcaacgcaaccgtgcccac
agcgagtcaggacttaccggtgttctgatggaggggcgatcgtccgagccgattcaggag
ggggagggccaatggtgtcttgccgttcccgacgatctagccggcgttgaagtgttgcgc
tgcagccgctgggatcccagcggagatggctcagacatctggactcccttttctgcagag
ggaagaattccggaaagcgataacgatcgtgagagccgcgctggcgagcaggccagtgcc
gccatggtggtgaaattcatcttggctccaggggaatcacgcgagattccagtggtgatc
agttgggatctgccgattacagcctttgcctccggctgtgcggaccgccgtcgctatacc
gacttctttggcagcgatggccgaaatgcagctgcgatcgcagcggaagccttgagggat
tggagtgattggcgagggcgaattgaggcttggcagcaacccgttttggagcggaaagct
ttgccggaacctgtgcgcatggctttattcaatgagctctacgacctctgcagtggtggc
agcctctggacggcggcgacggcgcaggatccctacggccgatttggggttctggagtgt
cttgactacgcctggtacgaaagcttggacgttcgtttgtacggctccttggcgttgctt
cagctctggcccgagctggataaggctgtcttgcgcagtttttcccgtgcgattccggcc
catgacgcaacccaacgccccatcggttggtacttcacccaaggccggggaagggttgag
gccgatcgcaaggtcgcaggtgcgaccccccacgatctgggcgctccgaatgagctgcct
tttgatgccaccaactacaccgcctatcaagattgcaatctctggaaagatctggccagt
gacttcgttttgcaggtgtggcgaaccttccagctcgcgccaaccggtgaagatttgaac
tttctggcggattgctggccatcggcggttcgagccttggattacctcaagggttttgac
gtcaatgacgacggtctaccggataacggcggagcgccggatcaaacatttgatgattgg
cccttgaaaggggttagcgcctattgcggggcgctttggatcgcagcgttggaagcggca
ttggcgatggcgcaacggctgcagctcgaccttggcctcgacaccaccgtggagcagcgc
cgctttgggcagtggcttgaacaatcgaggagcaactttgatcgtttgctttggaatggc
gagtactacgaaatcgatgctgaaagcggaacgcctgtggtgatggcggatcagctctgt
ggtgatttctatgcgcgtttgttgggcttgccatctgtggtgagtgacgccaatgccctt
agcaccttgaatgtggtgcgggacgcctgctttgagcgtttcgagggcggcacccttggc
gtcgctaacggcttgcgacgcgatggaactccactcgatccaaatggaacgcatccgctt
gaggtgtggactggaatcaatttcgggattgccagctatttccgtttaatgggccagagc
gatacggctttagcgattactggagcggtggtgaatcaggtgtactccggtggcttgcag
ttccgaacgcctgaggcgataacagctgtgaacaccttcagggcctgtcattacctcaga
gccatggcgatttggggcttgtgggctaccgacaccgattgggctgaaatcccaggtgct
tctgagcgttga

DBGET integrated database retrieval system