KEGG   Synechococcus sp. CC9902: Syncc9902_1533Help
Entry
Syncc9902_1533    CDS       T00293                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sye  Synechococcus sp. CC9902
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Syncc9902_1533
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Syncc9902_1533
Enzymes [BR:sye01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Syncc9902_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1482363..1483661
Genome map
AA seq 432 aa AA seqDB search
MVGAIASQQSVTQHLNVKGGQRLQGTLTVSGAKNSALVLMTASLLTDETVELVNVPDLTD
IQGMGDILGALGVQVERSDGRVALTAKQLTNAEPPYELVNSLRASFFSIGSLLGRMGHAK
VPLPGGCRIGARPVVEHIRGLKALGAVVTVQHGIVTASAKGSNRRLKGAAIVLDCPSVGA
TETILMAAVLAEGTTKIENAAQEPEVQDLANLLNVMGAKVTGAGGPVITVEGVPSLHGCR
GYAVIPDRIEAGTFLMAAAITRSSMCVEPVVPEHMNAVLQKLRDCGCSLEINGRSIQITP
GDIVATDITTQPFPGFPTDLQAPFMALMSTAKGTSVISEKIYENRLQHVAELQRMGAAIR
VDGSTAIVQGVPSLSGAPVTGSDLRAAAAMVLAGLSACGTTQVSGLGHLDRGYDNVEAKL
RGVGATVERDGF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggtgcaattgcgtctcaacagagtgtcacccagcatctgaacgtcaaaggcggt
caacgtttacaaggcaccttgaccgtgagcggtgccaaaaattcagccctggtgttgatg
acagccagtctgttgaccgatgaaacggtcgaattagtcaatgttccagacctaactgat
attcaaggaatgggcgacattctgggtgcgcttggagtgcaggttgagcgcagtgatggt
cgggtggctctaactgcaaaacaactcactaatgcagagcctccctacgaactcgtcaat
agcctgcgcgccagttttttcagcattggctccctcctcggtcgaatgggtcacgccaaa
gttcctctcccaggtggatgccgtattggagcccggcccgttgtggaacacattcgtgga
cttaaggctcttggcgcagtcgtcaccgtccaacacggcatcgtgacggcttcggcaaaa
gggtccaaccgacgactcaagggcgctgccatcgttttggattgccccagcgtgggcgcc
acagaaacaattttgatggccgccgtcctcgcggaaggcaccaccaaaatcgaaaacgct
gctcaagaacccgaggttcaagaccttgccaacctgctgaatgtgatgggagccaaggtg
actggcgcagggggacccgtgatcacggttgaaggagtgccttcacttcatggttgccgc
ggttacgccgtaattcctgatcgcatcgaagccggcacctttctcatggctgctgcgatt
acccgttccagcatgtgtgtagagccggttgtaccagagcacatgaacgctgttcttcaa
aaattgcgtgattgcggttgctccctcgagatcaacggcagaagcatccaaatcacccct
ggggacatcgttgcaacagacatcacaacccaacctttccctggctttccgaccgacctt
caggctccgttcatggccctgatgtcaacggcgaaaggcaccagcgtgatcagcgaaaaa
atctatgaaaatcggcttcagcacgttgctgagctgcaacgcatgggggctgccattcgc
gttgatggcagcacggccatcgttcaaggcgtgccgtccctcagcggtgcacccgtcacc
ggcagtgatcttcgagcagcggcggcgatggtgctggcgggattatcagcatgcggcacc
actcaggtgtcgggtttgggccacctcgatcgtggctacgacaacgttgaagccaagctt
cgtggtgtaggcgcaaccgttgaacgcgacggtttctaa

DBGET integrated database retrieval system