KEGG   Synechococcus sp. CC9902: Syncc9902_1587Help
Entry
Syncc9902_1587    CDS       T00293                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sye  Synechococcus sp. CC9902
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Syncc9902_1587
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Syncc9902_1587
Enzymes [BR:sye01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Syncc9902_1587
Peptidoglycan biosynthesis and degradation proteins [BR:sye01011]
 Precursor biosynthesis
  Amino acid ligase
   Syncc9902_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1535150..1536658)
Genome map
AA seq 502 aa AA seqDB search
MGQLLDELLRDVGLTPPAGGTNPQIEAVTSDSRLAGPGSLFVGLPGERVDGGLFWRQALN
AGAAAAVIGPAAAASDPPGDHDQVLVVSEPVASTLGELASSFWNRPSERMALLGVTGTNG
KTTTTYLIEHLALACGRSTALFGTLVNRWPGHSVTATHTTAFADRLQAQLSEAASAGSQL
AAMEISSHALAQHRVAGCRFAGAVFTNLTQDHLDYHLSMQDYFEAKALLFSEALLQAGPA
RAVVNGDDPWGAKLAERLGSQCWRSSFTDSTAELRMEDLSMTSRGVSGRLISPLGEGAFQ
SPLLGRFNLMNLLQAVGVLLQQQLPLPDLLRAVSDFRGVPGRMERVLLEDAMTNSLPTVL
VDYAHTPDGLENALAAARPFAEGKLICVFGCGGDRDRGKRPQMAAIAARLADRVVVTSDN
PRTEDPQRILEDVLQGIPDGVDRVVESDRGVAIAQTIAEADAADLVLVAGKGHEDYQILG
TEKVHFDDREEAQKALRLRLQP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagctcctggatgagcttctgcgagatgtgggcctcacgccccccgcaggtggg
accaatccgcagatcgaggccgtcaccagtgactcccgcttggctggcccaggcagcttg
tttgtgggattgcctggtgagcgggtcgatggaggtttgttttggcgtcaagccttaaac
gcgggtgccgcggcggcggtaattggtccagcggctgctgcttcggatccaccaggggat
cacgatcaggtgttggtggtgtccgagccagtggccagcacgcttggtgagctggcgtcg
tcgttttggaaccgaccgagtgagcgaatggcgctgttgggtgtgaccgggacgaatgga
aaaaccaccaccacctatctgatcgaacatctggccttggcctgtggacgatccaccgcg
ttgtttggcaccctcgtgaatcgttggcctggccacagcgtcaccgccacccacaccacg
gcgtttgctgatcgcctgcaggcccaattgtcggaggcggcatcggctgggagccagctg
gcggcgatggaaatcagttctcatgctctggcacagcaccgggtggcggggtgccggttt
gctggcgctgtgttcacgaatctcacccaggaccacctcgactaccacctctcgatgcag
gactacttcgaggcgaaggccctgttgttttcggaggcgttgctgcaagccggccccgcc
cgggcggtggtgaatggcgatgacccctggggggcaaagctggctgaacggcttggatcg
cagtgctggcgcagctcttttaccgattccacggcggagttgcgaatggaggatctcagc
atgaccagccgcggggtatcaggccggttgatcagtcccctgggagagggtgcgtttcag
tcgcctctgttgggtcgcttcaatttgatgaatctgttgcaagcggtgggtgttctgctc
cagcaacagttgcccttgccagatctgctgcgggcagtgagtgatttccgaggcgtgcct
ggccggatggaacgggtgctgttggaggacgcgatgaccaattcgctccccacggtgttg
gtggactatgcccatacgccggatgggttggagaacgctcttgccgctgcaagacccttt
gccgagggcaagttgatctgcgtgtttggctgcggtggtgatcgcgaccggggcaagcgt
cctcaaatggccgcgattgcggcgcgcttggccgatcgggtggtggtgacctccgataac
ccacgaaccgaggatccccagcgcatccttgaggatgtgctgcagggcattccggacggt
gttgatcgggtggtggaatcagaccgtggggtggcgattgcccaaacgattgctgaggct
gatgccgctgatctggtgctggtggctggtaaaggccatgaggattaccagattcttggc
accgagaaggtgcactttgacgaccgagaggaagcgcaaaaagcactacgtcttcggctt
caaccttga

DBGET integrated database retrieval system