KEGG   Synechococcus sp. CC9902: Syncc9902_1631Help
Entry
Syncc9902_1631    CDS       T00293                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sye  Synechococcus sp. CC9902
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Syncc9902_1631
Enzymes [BR:sye01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Syncc9902_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1578371..1579126)
Genome map
AA seq 251 aa AA seqDB search
MTTTVPFVSRGAALSNGNGNATLHPDLASKIRERLQNAGVPFLANDNISDHLEPGELSLL
EIEVADKVRDLLRTLVIDIDNDHNTSETAERVARMYLHEVFKGRYHPQPKVASFPNVKQL
DEIYTVGPITVRSACSHHLVPIMGNCWIGIKPGVRVIGLSKFTRVADWVFSRPHIQEEAV
MILADEIEKLCEPQGLGIIVKAQHYCMKWRGVKEPQTSMVNSVVRGDFRHDPSLKQEFFE
LVRQQEALLSS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaccgtccccttcgtttcccgcggcgctgctctcagcaacggcaatggcaac
gcaacactccatcccgatcttgcttcgaagatccgcgaacgtcttcagaacgctggcgtt
ccattcctcgcgaatgacaacatctccgatcatttagagccgggtgaattatctcttctt
gagattgaggtggccgacaaggtgcgcgatttgctgcgcactcttgtgattgatatcgat
aacgatcacaacaccagcgagaccgctgagcgtgtggctcggatgtatctccatgaagtt
tttaaaggtcgttatcaccctcagccgaaggttgccagcttcccaaatgtgaagcagctg
gatgagatttataccgtgggaccaatcacggttcgatccgcttgctcccaccaccttgtt
ccaatcatgggcaattgctggattgggattaagcctggagttcgtgttattggattgtcc
aaattcacccgtgtcgctgattgggtgttctcacgtcctcatatccaagaggaagcggtg
atgattttggccgatgagattgaaaagctttgcgaaccgcagggactaggaatcatcgtc
aaagcacagcactactgcatgaagtggcgcggtgtgaaagagccccaaacaagcatggtg
aattccgtggtgcgaggtgatttcaggcatgaccccagcctcaagcaggagttctttgaa
ttggtccgacagcaggaagccttgctgagttcttaa

DBGET integrated database retrieval system