KEGG   Synechococcus sp. CC9902: Syncc9902_1795Help
Entry
Syncc9902_1795    CDS       T00293                                 

Definition
CysQ protein-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sye  Synechococcus sp. CC9902
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sye00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1723525..1724442)
Genome map
AA seq 305 aa AA seqDB search
MMSNSAILPAGVSKEALLTELRRLSWGAADILRAYARGEQPPHGFQKALSVDNGGEGPVS
AADLAVNQWLLEGLSGAFPDAGWTLLSEETAKEQLTEGEPLPAEWLWILDPLDGTKDFLQ
GTGEYAVHLALVRGNRPVLGVVLLPEADELWIGLVGDGAWCEDREGTRSPVRFSQREELS
DLLLVASRSHRDDRLEKLIGELQLGGSKAVGSVGCKVATILRGETDLYISLSGRSAPKDW
DMAAPEAVLLAAGGRFTHADLGDLTYNTGDVRQAGCLIASHGKAHVALGERATRAMAEID
PGFQV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccaactccgccattctccctgctggtgtcagcaaagaagctttgttgaccgag
ttgagacgattgagttggggggcagccgacattcttcgtgcgtatgcccgtggcgaacag
cctccccatggctttcagaaagccttgagtgtcgataacggtggagaggggcctgtttcc
gcggctgatctggccgtgaaccaatggcttctcgagggtttatcgggggctttccccgat
gctggttggactctgcttagtgaggaaaccgccaaagaacagctcaccgaaggtgagcct
ctgcccgccgaatggttgtggatccttgatccgcttgatggcaccaaggattttctccaa
gggactggggaatatgcggtgcacctcgctttggtgcgggggaatcggcctgttttaggg
gtggtgttgttacccgaagccgatgagctatggattggcttagtgggtgatggcgcctgg
tgtgaagaccgtgaaggaacgcgttcacccgttcgcttcagccaacgcgaggaattgtcc
gacctgctactagtggcgagccgtagtcatcgcgatgaccggcttgagaaattgatcggt
gaactgcaactcggtgggtcgaaggcggttggcagtgtgggctgcaaggtggccacgatt
cttcgtggagaaaccgatctctacatctctctctcgggccgtagtgctccaaaggattgg
gatatggctgcaccggaggctgttttgttggcggctggtggacgatttacccacgctgat
ctcggcgacctcacctacaacacgggcgatgttcgtcaggctggctgtttgattgccagc
catggaaaagcccacgtcgcgctcggagagcgtgcgacgcgggcgatggccgagattgat
cccggctttcaggtgtaa

DBGET integrated database retrieval system