KEGG   Synechococcus sp. CC9902: Syncc9902_1813Help
Entry
Syncc9902_1813    CDS       T00293                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sye  Synechococcus sp. CC9902
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Syncc9902_1813
Enzymes [BR:sye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Syncc9902_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1736252..1737181)
Genome map
AA seq 309 aa AA seqDB search
MNPSTAFGLIKTGTGVGYEACTHPAPVVLNQPLELESPPKLQQLCLAVVGHIEWVDFLAV
DHWPQPGLISHAQQRLEEPAGAGAVIAVQLAQLVDRPVHFFTALGRDSVGEACVQRLQER
GVEVHVAWRDAPTRRGISLVDEGGDRGITVIGDRLTPVSSDPLPWDVLRECDGAFVTAAD
AALVQIARTVPVLAATPRVGLAVLRSAGVQIDALIGSGLDPAEIVEPGALSPLPAIQIST
EGEAGGMISTGDRYSASALPGPLIETYGCGDSFAAGVFAGLAAQWPLERAIELGCQLGAA
CATRFGPYE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatctacggcctttggtctcatcaagacgggcactggagttggatacgaagct
tgcactcacccagctcctgttgttttgaatcagcctttggaacttgagtcgcctccgaag
ctccaacagctttgtttagccgttgttggtcatatcgaatgggttgattttcttgccgtg
gatcattggcctcaaccgggcttgattagtcatgcccaacagcggcttgaggagccggca
ggtgctggagccgtgattgctgttcagttggcacaacttgtggatcggcctgtgcatttc
ttcacggccctgggacgtgattccgttggagaagcctgtgttcagcgtcttcaggagaga
ggtgttgaagtccatgtggcgtggcgcgacgctcccacccgtcgtggcatcagcttggtg
gatgaaggaggagatcgaggaatcacggtgattggtgatcgtctgactcctgtttcgagc
gatcccttgccttgggatgttttgcgtgaatgtgatggtgcgttcgtcacggcggccgat
gccgctttggtgcagatcgctaggaccgtgcccgtactggcagcaacgccgcgggttggt
ttggcggtgttgagatccgctggcgtccaaatcgatgccttaattgggagcggactggat
ccagcagagatcgtggaaccaggagcgttgtcgcctctcccagcgattcagatttccacg
gaaggtgaagcgggggggatgatcagtaccggtgatcgctacagcgccagtgccctgccg
ggcccgttgatcgaaacctatgggtgcggcgatagttttgccgcgggtgtctttgctggt
cttgcggcccagtggccgttagagagagccattgagctgggatgtcagcttggcgctgca
tgtgcaactcgttttgggccctatgagtga

DBGET integrated database retrieval system