KEGG   Synechococcus sp. CC9902: Syncc9902_1835Help
Entry
Syncc9902_1835    CDS       T00293                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Syncc9902_1835
Enzymes [BR:sye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Syncc9902_1835
Exosome [BR:sye04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Syncc9902_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1759993..1761498
Genome map
AA seq 501 aa AA seqDB search
MAHQPLLLALDQGTSSSRAVVFNPAGDLVASASAPLPIQYPADGWVEQDPLEIWASQRQA
LIDLQRKLRDDQRQAVVSCGITNQRETTVLWRRSTGVPCGPALVWQDGRTASICADWKRQ
GLEQDWRRRTGLLLDPYFSASKIRWMLEHYGEAAAAAAADDLCFGTVESWLLWQLTEGQH
HGSDLSNASRTLLLDLEQRQWVDDFRIHTGLPANALPELLPCRGDIAQIAAGLPFEGLPI
QAMLGDQQAATLGQLCLQPGESKCTYGTGAFLVINTGNEIRRSEAGLLSTLGWTDADGVP
TYCLEGSLFNAGTVIQWLRDGLQIIERAEQVNDLANQVADSGGVMLVPAFTGWGTPHWNP
EARGILVGLTRDSNRCHIARAALEGIALSVSTLVDLAEQALGHGLGELAVDGGAAASDPL
LQAQADSTGLTVRRPASLESTARGVALFAGLQAGVVNDLNNLALHRRDGAQLFQPQCDAA
ERKAWRTRWDNAVTRSLNWHE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatcagcctctcctgttggccctggaccagggcacgagcagctcccgagctgtg
gtcttcaatccggcgggtgatctggtcgccagcgctagcgccccactaccgatccagtac
cccgccgatggttgggtcgagcaggatccactggagatctgggcgagccaacggcaagcc
ctcatcgaccttcagcggaagctgagggacgaccaacgccaagcagtggtgagctgtggc
atcaccaaccaacgggaaacaaccgtgctttggcgacgcagcaccggtgttccttgcggg
ccagcgctggtctggcaagacgggcggaccgcatccatctgcgcagactggaaacgccag
ggattggaacaggactggcggcgacgcacagggctcttgctcgatccctatttcagtgcc
agcaagatccgctggatgctggagcactacggagaggcagctgccgcggctgccgcggat
gacctctgctttggcactgtggaatcgtggctcctttggcagctcaccgaaggacaacat
cacggaagcgatctgagcaacgccagccgcacactgctgctggatctggagcaacgccag
tgggtggatgacttccgcatccataccggattgccagccaatgccttgcccgagctgctg
ccctgccgaggggacatcgcccaaattgctgcaggcttgccctttgaagggctaccgatt
caggccatgctcggggatcaacaggccgccaccctcggacaactctgcttgcaacccggt
gaaagcaaatgcacctacggaacaggagcgttcctcgtgatcaacaccggcaacgagatt
cgtcgatccgaagccgggctactcagcaccctggggtggaccgacgctgatggcgtgccc
acctattgccttgaaggcagccttttcaatgccggcactgtgatccagtggctgcgggat
ggcctccaaatcatcgagcgagcagagcaggtgaacgacctcgccaatcaagttgctgat
tccggcggcgtgatgttggtgccagctttcacgggctggggcaccccccactggaacccc
gaagcacgggggatcctggtggggctaacccgcgatagcaaccgctgccacattgcaagg
gccgccctggaaggaatcgccctctctgtatccaccctggtggatctcgcggaacaagcc
ctcgggcatgggctgggagaacttgcagtggatggaggtgccgccgcctcggatccgctc
ctgcaggcccaagcagacagcacaggactcacggtgcgacgacccgccagtctggaaagc
acggcacgaggcgtggcgttgtttgcaggtttgcaagctggagtggtcaacgatctgaac
aaccttgccctccaccgacgggatggagcccaactcttccaaccgcagtgcgatgcggct
gagcgcaaggcttggcgaacccgttgggataacgccgtaacccgcagcttgaactggcat
gagtga

DBGET integrated database retrieval system