KEGG   Synechococcus sp. CC9902: Syncc9902_1933Help
Entry
Syncc9902_1933    CDS       T00293                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00620  Pyruvate metabolism
sye00680  Methane metabolism
sye00710  Carbon fixation in photosynthetic organisms
sye01100  Metabolic pathways
sye01120  Microbial metabolism in diverse environments
sye01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Syncc9902_1933
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_1933
   00680 Methane metabolism
    Syncc9902_1933
Enzymes [BR:sye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Syncc9902_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABB26890
JGI: Syncc9902_1933
CyanoBase: Syncc9902_1933
CYORF: Syncc9902_1933
UniProt: Q3AWA1
Position
1847488..1850475
Genome map
AA seq 995 aa AA seqDB search
MPESTAHALQGEQPRESGVTAGAGRLLQNRLVLVEDLWQTVLRSECPPEQSARLLRLKQL
SDPVALEGRDGDSTSEAIVELIRAMDLSEAIAAARAFSLYFQLINILEQRIEEDSYLDSL
APRKSAADDGRDAFDPFAPPLASQTDPATFGEVFERLRRMNVPPAQVEALLQELDIRLVF
TAHPTEIVRHTVRHKQRRVANLLQQLQSDSPMALQVKDDLRQQLEEEIRLWWRTDELHQF
KPTVLDEVDSTLHYFQQVLFDAMPQLRRRLTSSLHRHYPDVQVPQASFCTFGSWVGSDRD
GNPSVTTDITWRTACYQRQLMLELYISSVQALRNQLSISMQWSQVAPALLESLEMDRLRF
PEIYERRAARYRLEPYRLKLSYILERLERTLKRNDQLSDAGWKSPKDAIPTDGPPGSEAL
HYTSVDQFRNDLELIRNSLIGTELTCEQLDTLLHQVHIFGFSLASLDIRQESTRHSDAID
ELTRFLELPQPYGEMEESTRVAWLIEELRTRRPLIPTAVRWSDTTAETMAVFRMLHRLQE
EFGQRICHSYVISMSHTASDLLEVLLLAKEAGLVDPAARKASLLVVPLFETVEDLQRAPA
VMDELFNTPLYRDLLPMVGIQGQPLQELMLGYSDSNKDSGFLSSNWEIHQAQLALQELSS
RQGVALRLFHGRGGSVSRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASKYSLPELALY
NLETVTTAVVQNSLVTNQLDATPSWNQLMSRLSARSREHYRALVHDNPDLVAFFQQVTPI
EEISKLQISSRPARRKTGAKDLSSLRAIPWVFGWTQSRFLLPSWFGFGTALAEEVKADPD
QLDLLRRLHQRWPFFRTLISKVEMTLSKVDLDLAHHYMNSLGKPEQREAFEAIFAVIATE
YALTRKLVLEITGQPRLLGADQGLQLSVDLRNRTIVPLGFLQVALLKRLRDQNRQPPMSE
SPGAPEDTRTYSRSELLRGALLTLNGIAAGMRNTG
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagtccaccgcccatgcactccaaggcgaacagcccagggagagcggtgtgact
gctggagccggccgattgctgcagaaccgcttggtgttggtcgaagacctttggcaaacg
gttctccgcagcgagtgtcccccagaacaaagtgctcgcctcctccgactaaaacaactg
agtgatcccgtggcccttgaggggcgagacggtgacagcacaagcgaggcgattgttgaa
ttgatccgtgccatggatctttcagaagccattgccgcggccagagcgttctcgctgtat
ttccaactcatcaacatcctcgaacaacgcatcgaggaagacagttatctcgacagcctg
gccccccggaaatcagcagcagacgacggccgcgacgcctttgacccttttgctcctcct
ttggcgagtcagaccgatcccgccacatttggagaagtttttgaacggctccggcggatg
aatgtgccgccagcacaagtcgaagccctactccaggagttggatatccggttggtcttt
accgctcatcccacagagattgttcggcacaccgtccgtcacaagcaacgacgggtcgcg
aatcttctgcaacaactgcagtccgactcgcctatggcgcttcaagtcaaagacgacttg
cgtcagcaactggaagaggagattcgactctggtggagaaccgatgagctgcatcagttc
aagccaacggttctcgatgaagtggattcaacccttcattacttccaacaagtgttgttc
gatgccatgccccaactacggcgacggctcacatcatcacttcaccggcactatcccgat
gtccaagttccccaggcatcgttctgcacctttggatcttgggttggttccgaccgggat
ggcaatccctccgtcacaacggacatcacctggcggaccgcctgctatcagcgtcagctc
atgctcgagctgtacatcagctcggtccaggcgcttcgtaatcagctgagcatttcaatg
cagtggagccaggttgctcctgcgttgctggagtccttggaaatggatcggctgcgcttc
ccagagatctatgagcggcgcgcggcgcgttaccgactagagccttaccgactaaagctg
agctacatcctcgaacgcctggaacgcacgcttaagcgcaacgatcagctctcagatgcg
gggtggaagagtcctaaagatgccatcccaaccgatggaccgcctggatcggaagcgctc
cactacacctcggtcgatcaattccgaaacgacctggaactgatccgcaacagcttgatc
ggcactgaactcacctgcgagcagctcgataccttgctccatcaagtccatatctttggc
ttctcactcgccagtctcgatattcgtcaggagagcacccgccatagcgatgcgattgac
gaactcacgcgttttctcgaattaccacagccctatggcgagatggaagagtccacgcgt
gtggcctggttgattgaagagctccgtacccggcgtccgttgattccaacggcagttcga
tggtcggacaccaccgcggagacgatggccgtcttccgcatgttgcatcgactccaagag
gagttcggccagcggatctgccactcgtatgtgatttcgatgagccacacggcctccgat
ctattggaggtgttactgctcgcgaaggaagcaggactcgtggatccagccgcccgcaaa
gcgtcgctgctggtggtgccactgttcgaaacggtggaagatctacaacgcgcaccagcc
gtcatggacgagctgttcaatacacctctttatcgcgacctactcccgatggtggggatc
caaggccagcccctacaggagctaatgcttggctactccgacagcaataaagactcaggt
ttcctctcgagcaactgggagattcaccaagctcaacttgccctccaagagctgtccagt
cgacagggcgttgcccttcgactgtttcatggtcgcggcggttccgtgagccgtggcggt
ggcccggcgtatcaagccatccttgcccagcccagtggcacccttcagggccgcatcaaa
atcaccgaacaaggggaggtgctggcttcgaagtacagcctgccggagctcgccctctac
aacctggaaacagtcaccaccgcggtcgttcaaaacagcctggtaaccaatcagctcgat
gcgacaccgagctggaaccaactcatgagtcgtctctctgcacgctcccgtgagcactac
cgcgcgttggtacatgacaaccccgacttggtggcatttttccaacaggtgacaccaatc
gaagagatcagcaaactgcagatttccagtcgacctgctcgacgtaaaaccggagccaaa
gatctttcaagcttgcgggcgattccttgggtgtttggctggacgcaaagccgtttttta
cttcccagttggtttggctttggcacagctttagctgaagaggtgaaagcagaccccgat
caactcgatctgctccggcggcttcaccaacgctggccctttttccgcaccctgatttcc
aaggtggagatgaccctctccaaagtggatctcgacttagcgcatcactacatgaacagc
ctggggaaacccgagcaacgtgaggccttcgaggcgatttttgcggtgattgcaacggaa
tacgcgttaacgcggaaattggttttagagatcacaggacaaccgcgcctactcggggct
gatcaagggcttcagctctcagtcgacctgaggaatcgcacgattgtgcctttgggcttt
ctccaggttgcgctgctcaaacggctgcgggatcaaaaccgtcagccaccaatgagtgaa
agtccaggagcacccgaagacacccgtacctacagccgcagtgagttactccgtggggcc
ctgctcacgctgaatgggattgctgctggcatgcgcaacacaggctga

DBGET integrated database retrieval system