KEGG   Synechococcus sp. CC9902: Syncc9902_2098Help
Entry
Syncc9902_2098    CDS       T00293                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00260  Glycine, serine and threonine metabolism
sye00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sye01100  Metabolic pathways
sye01110  Biosynthesis of secondary metabolites
sye01130  Biosynthesis of antibiotics
sye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syncc9902_2098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Syncc9902_2098
Enzymes [BR:sye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Syncc9902_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABB27056
JGI: Syncc9902_2098
CyanoBase: Syncc9902_2098
CYORF: Syncc9902_2098
UniProt: Q3AW11
Position
complement(2002885..2004141)
Genome map
AA seq 418 aa AA seqDB search
MTSTLPKASQPDPSSLQPSARPGAHGRFGRFGGQYVPETLMPALAELEQSAAQAWADPAF
TGRLNHLLKTYVGRATPLYEAERLTAHYRRDDGGPRIWLKREDLNHTGAHKINNALGQAL
LALRMGKKRIIAETGAGQHGVATATVCARFGLDCVIYMGAEDMRRQALNVFRMRLLGATV
APVTAGSATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGQEAKQQC
EEAFGRLPDVLMACVGGGSNAMGLFHPFVQDTSVRLIGVEAAGDGVNTPRHAATITEGRA
GVLHGAMSLLLQDSDGQVQEAHSISAGLDYPGVGPEHSYLKEIGRAEYAAVTDEQALDGL
RLVSELEGIIPALETAHAFAWLEQLCPTLPQGCEVVINCSGRGDKDVNTVAEKLGDKL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcactctgccgaaagcctcccaaccggatccctccagccttcaaccgtcggcc
cgtccaggtgcccatggacgtttcggacgcttcggtggccagtacgttccagaaactctc
atgccagcgttggcggagttggagcaatcggcagctcaagcctgggcagatccagcgttt
acggggcgactcaaccatctcctcaagacctacgtcggtcgggccactcccctctatgaa
gccgagcgactcacggctcattaccgccgagacgatggtggcccgcgcatttggctgaag
cgtgaggatctaaaccacaccggcgctcacaaaatcaacaatgctctcggccaggcgctt
ttggccctgcggatgggcaaaaaacgaatcattgctgaaaccggggctggtcagcatggt
gttgccacagcaaccgtctgtgcccgatttggcctcgattgtgtgatttatatgggcgcg
gaggacatgcgccgacaagccctcaatgtgttccgtatgcgtcttcttggcgccacggtg
gcaccggtcacagctggctcagccacgttgaaggacgccaccagcgaggcgattcgcgac
tgggtgacgaatgtggaaaccactcactacatcctcggttctgttgctggtccgcacccc
tacccgatgttggtgcgcgattttcacgcggtgatcggtcaggaagcgaaacagcagtgt
gaggaagcctttggccgcctgccagatgtgttgatggcctgtgtgggagggggctcgaac
gcgatggggctgttccatccctttgtgcaagacacctcggttcgtctgattggtgtagag
gccgctggtgacggtgtgaatacccctcgccatgccgccaccatcaccgaaggccgcgcc
ggtgtgttgcatggtgcaatgagcttgctgttgcaagacagtgatggtcaggtgcaagaa
gcccattccataagtgctggtttggactatcccggtgttggccctgagcacagctatctc
aaggagattggccgggctgaatacgcagcagtcaccgacgaacaggccctggatggattg
cgcttggtgagtgagttggaggggattattccggcccttgaaacagcccatgcctttgct
tggttggagcagctttgccccacccttccccagggctgtgaagtggtgatcaactgctcg
ggacgtggcgacaaagatgtcaacacagtcgctgagaagcttggcgacaagctctga

DBGET integrated database retrieval system