KEGG   Synechococcus sp. CC9902: Syncc9902_2191Help
Entry
Syncc9902_2191    CDS       T00293                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sye  Synechococcus sp. CC9902
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Syncc9902_2191
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Syncc9902_2191
Enzymes [BR:sye01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Syncc9902_2191
Lipid biosynthesis proteins [BR:sye01004]
 Desaturase
  First
   Syncc9902_2191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2099771..2100673
Genome map
AA seq 300 aa AA seqDB search
MVSSQPADSRELRVRAAVTGPRGPLPARQRRLKSGTTGFMLVNHILATVALLPQFWSWQA
IVAFGVLYWMTVLGVTLGLHRLVAHRSLVVPVWLERVLVIMGTLACQSGPIEWVGLHRHH
HRFSDQPTDHHDAGRGLWWSHSEWMLHEIPALKELDRYAGDLQCDPFYRWLDRWFLLLQI
PLGLGLYWYGEAAQVHGGGLGLVLWAIPLRLVVVYHVTWLVNSATHAFGYRNFDSPDLSR
NCWWVAVLSFGEGWHNNHHAHPASARHGLRWFEFDITWQHVRLLKRFGLARRVREATYNP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttggtttcctcgcaaccagctgatagccgcgagcttcgcgttagggctgctgtaacgggc
ccccgtgggccattacctgcccgtcaaaggcgtctaaaatcaggaaccaccggcttcatg
ctggtgaatcacatcctggccaccgtggccttgctccctcagttttggagctggcaggcg
attgttgccttcggtgttctgtattggatgaccgttctgggggtcaccctcggattacac
cgtttggtggcgcaccgcagccttgtggttcccgtttggctggaacgcgtgctggtgatc
atgggcacgctcgcttgccagagcggaccgatcgaatgggttgggcttcaccgccatcac
caccgattctccgatcaacccacagaccatcacgatgctggacgggggttgtggtggagt
cacagcgaatggatgctccatgagattcctgcgctgaaagagctcgatcgctatgcggga
gatctgcaatgtgatcccttttaccgctggctcgatcgctggttcttgctgcttcaaatc
cccctgggattgggcttgtactggtatggcgaagctgcgcaagtccatggcggcggattg
gggctcgttctttgggccatccccctacgactcgtggtcgtgtatcacgtcacttggctg
gtgaactcagcgacccacgccttcggatatcgcaattttgattcacccgacctctcgcgg
aattgctggtgggtggccgtgctctcgtttggagagggttggcacaacaaccaccatgcg
caccctgccagcgcacgccatggcctgcgctggtttgaatttgatatcacctggcagcac
gttcgcctcttaaaacggtttggcctcgcgagacgggtccgtgaagccacgtacaaccct
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system