KEGG   Synechococcus sp. CC9902: Syncc9902_2230Help
Entry
Syncc9902_2230    CDS       T00293                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sye  Synechococcus sp. CC9902
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Syncc9902_2230
Enzymes [BR:sye01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Syncc9902_2230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2138164..2139027
Genome map
AA seq 287 aa AA seqDB search
MNTNLFDADGAIYMGSQRTPEHCRVGLFGVPYDGTTSFRPGTRFGPAAIRDVSSGLETYC
PQLDRDLEDLSFVDLGAVEIPFGAPEPVIAKVQQATQAILELGLKPLMLGGEHSISSGAV
AAVAQQHPDLVLVQLDAHADLRHEWLGSHHSHACAMRRCLEILPSGDLFQLAIRSGTKAE
FQELHSSGRLMPTVDALREGLAPHKGRPIYVTVDLDWFDPAVLPGTGTPEPGGFFWPDFA
NLISLLQEHRLVGADVVELAPQLDSSGVSAVLAAKVTRSLLLLLGNG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaatttgtttgacgccgatggtgcgatctatatggggtcgcaacggaccccc
gagcactgtcgtgtgggacttttcggcgtgccctacgacggcaccacatcgttccgaccg
ggcacccggtttggacccgccgcaattcgagacgtcagcagtggactagagacatactgc
ccgcaattggatcgggatctcgaagatctctccttcgtcgatctcggggctgtcgagatc
cccttcggcgcccctgaaccggtcatcgccaaggtgcaacaggccacccaagcgattctt
gagctcggcctgaaaccgttgatgctcggcggtgaacactccatcagctccggagccgtg
gctgccgtagcgcagcagcatcctgatctggttctcgtgcaactcgatgcccacgctgat
ctgcgccatgagtggttaggcagccatcacagccatgcctgtgccatgcgccgctgcctc
gagatcctgcccagtggcgacctcttccaactcgccatccgtagtggaacgaaagcggaa
ttccaagaactccacagcagtggccgtctgatgccaacagtggatgctttgcgcgaaggc
cttgcaccccacaaggggcgcccgatctacgtcaccgttgatctggactggtttgatcct
gccgttttgccgggtacaggcacccctgaaccaggaggatttttttggcctgatttcgcc
aatctcatcagcctgctccaagagcatcggctagtgggcgcagatgttgttgaactcgca
ccacagctcgatagcagcggtgtgagtgctgttctcgccgcaaaagtgacgcgtagcttg
ctgctgctcctcggcaatggctaa

DBGET integrated database retrieval system