KEGG   Synechococcus sp. CC9902: Syncc9902_2243Help
Entry
Syncc9902_2243    CDS       T00293                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sye  Synechococcus sp. CC9902
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sye00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2152051..2153778)
Genome map
AA seq 575 aa AA seqDB search
MQPSSDETLRTLLSDLYRDDSPGDLEKLSSQLLQILSQSSEDHDVPIGSPRWKGDDAVLI
TYANTVADDAAFGLQSLRGLVNRHLEPFARVIHVLPFLKSTSDGGFAVSSYQKIEQQYGD
WSDLSALAEGRRLMADLVLNHVSASHPWVQQFLRNEQPGESCVLEASPDPCWNDVVRPRS
SALFTQLSGPNGRRQVWTTFGPDQVDLDWHHPQVLIGFIELLNRLLGHGVRWIRLDAVGF
VWKEPNTSCIHLPQAHRLVQVLRYLLDRHGPDGVVVTETNVPEQENLSYLRNGQEAHLAY
NFPLPPLLLEAAMSGRADLLNGWLTRWPQLPNQTGLLNFTACHDGVGLRPLEGLMADQRV
LQLLVGCERRGGLISHRRLNNGEEVPYEINISWWSAMADGGIDPTYLQRERFLLTQLMIM
ALPGVPAFYLPALLAAPNDLTRFRRTGHRRDLNRPQFTAQALERRLADPDADVSALLPVL
KRALSERAVHLALHPDASMQVLSADRLDRVILQRSYGGETLVAVHNITASRLSLRLGRLG
GDVNQPWADCLSGHVFAPHQLHSLEPYAVHWLVQP
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctcaagcgatgaaacgctgcggactcttcttagtgatctctaccgggatgat
tctcccggtgatctcgagaagttgtcgtcgcaattgctgcagattctgagccaatcgtca
gaggatcatgacgttccaattgggtcgccccgatggaaaggggacgacgctgttttgatt
acttatgcgaatactgttgcggatgatgcagcttttggactgcaaagtcttcgtggattg
gtgaatcgccatttggagccatttgctcgggtgattcatgttttgccatttctaaagtcc
acgagtgatggtggttttgctgtttcgagttatcaaaaaattgagcaacagtacggcgac
tggtcggatctcagtgcattggctgaggggcgtcgcttgatggcagatcttgttctcaat
catgtttctgcatctcatccttgggtgcagcagttcctccgaaacgagcaacctggcgaa
tcatgtgtgctggaagcgagtccagatccttgttggaacgatgtggttcgtccgcgtagt
tccgccttgtttacgcagctcagtggtcccaatgggcgccgtcaggtttggaccacgttt
ggtcctgatcaggtggatttggattggcaccacccccaggtactgattggcttcatcgaa
ttactgaatcgattgttgggccacggggttcgttggattcgactcgatgctgtgggtttt
gtctggaaagagcccaacacaagctgtattcatctgccgcaggcccatcgcctcgttcag
gtgttgcgttatctgttggatcgccatggtcctgatggggttgtggtcacagaaacaaac
gttcctgagcaggaaaatctctcctatttgcgcaatggtcaagaggcgcatttggcttac
aacttccccctgccgccgcttttgttggaggcagccatgagtggccgagctgatcttctc
aatggttggttaacccgctggccccaattgccgaaccagaccggactgttgaatttcacc
gcgtgccatgacggtgtgggcttacggcctcttgaggggttgatggctgatcaacgcgtt
cttcagctcttggtgggttgcgagcgcagaggcggtttgatcagccatcgacgtctcaac
aacggtgaggaggttccctatgaaatcaacatcagttggtggagtgccatggccgatggc
gggattgatcccacctatctccaacgggagaggtttctgctcacccaactcatgatcatg
gccctgccaggggttcccgcgttctatctgccggcgcttttggcggctcccaatgatcta
actcgctttcgtcggacgggtcatcgacgggatctcaatcggccccagttcacggcccag
gccttggagcgacgcctggcggatcctgatgcggatgtatcggcgctgcttccggtgctg
aagcgggcgctttctgaaagggctgttcatctggctttgcatcctgatgcctccatgcag
gtgctgagcgctgaccgtcttgatcgcgtcatcctgcagcgttcctacgggggggaaacg
ttggtggctgtccataacatcacggcatcgcggctgagcttgcgccttggtcgcttgggg
ggtgatgtgaaccagccatgggccgattgcctgagcggtcatgtgttcgcaccacatcag
ttgcattcgctagagccttatgcggttcattggttggttcagccatga

DBGET integrated database retrieval system