KEGG   Synechococcus sp. CC9902: Syncc9902_2260Help
Entry
Syncc9902_2260    CDS       T00293                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sye  Synechococcus sp. CC9902
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Syncc9902_2260
Enzymes [BR:sye01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Syncc9902_2260
Peptidases [BR:sye01002]
 Cysteine Peptidases
  Family C44
   Syncc9902_2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2168185..2170209)
Genome map
AA seq 674 aa AA seqDB search
MCGIGGVFRTHSEHRVDQQLLVNMAAIQAHRGPDGFGIESLEGSGVGFCHARLSIIDLDG
NRARQPFLSEDNQVLMAHNGEFYDFQRIRADLTAQGVRFASKSDSEILLRLYQRQGLEQT
LPLLRGEFAFALYDRNQDCLYLVRDRFGVKPQYWTMTPEGLVFGSELKVLFAHPAVERRF
TSEGLFHQLMQTMVPGSTAFEGVYQVQPGHILKVQRCNGRLEVSDSTYWDINFPRMDERD
FTRHEADHVSAVRSALLEAVELRMVADVPVGCYLSGGIDSCSILGLASAVSQGPVKAFTI
GFDDVRYDESPIAQQMAEATGAQQDLMRLSGNELYGHMEQTLWHTERTIYNTLAVAKFLM
SRHVNSVDYKVVMTGEGSDELFGGYPAFRRDMFLHGLDDLPKEEREACECLLQDSNSLVQ
GAMLSAAQVDDPDLEAVVGFTPSCLQPWLACVPLVPDLLAEHHRIAVEGYSPGKAIAAQL
DGDQLDGRHALDKAQYVWIKTMLEGQILTWGGDRVDMANSMEARPAFLDHHLAAVAVQVP
PELRIKGKTEKYVLREAMAGLLPDVLYKREKFAFMAPPAHTEPEKWAQMQNLAADYLSDE
AIDAAGLLSKSGVKALFDRHDSPETTEADRVQMDAVINHLLGVQMLHRMFVATDVPQQAR
QEAERLGWRIPVEV
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatcggcggcgtctttcgtacgcattcagaacatcgtgtcgaccagcaattg
ctggtgaacatggcagcaattcaggctcatcgtggtccggatggctttgggattgaatcg
cttgagggtagtggtgttggtttttgccatgcccgtctttcgattattgatctcgatggc
aatcgggcgcgtcaaccgttcctcagcgaggacaaccaggtgttgatggcgcacaacggt
gagttttacgactttcagcgcatccgtgctgatctcacggcgcaaggcgttcgtttcgcc
agcaagagcgattctgaaattctgttgaggctttatcagcgacagggcttggagcaaacg
ctgccgcttttgcgtggagaatttgcctttgctctctatgaccgcaatcaagattgtttg
tatttagttcgggatcgttttggagttaagccgcagtattggacgatgacgccggaaggc
ttggttttcggctctgagctcaaagtgctgtttgcccatccagctgttgaacgtcgattt
acgtcggaggggttatttcatcaactcatgcaaacgatggtgcctggaagcaccgctttt
gagggcgtataccaagtacaaccaggccacatcttgaaggtgcaacgttgtaatgggcgc
ttagaagtctcggattccacctactgggatatcaattttcctcggatggatgagcgggat
ttcacgcgtcatgaagctgatcatgtgtcagctgtccgctctgccttgctggaggctgtg
gagttgcgcatggtcgctgatgtccccgttggttgttacctctctgggggaattgatagt
tgttcgattcttggtttggcgtcggctgtgagccaaggccctgtgaaagctttcacgatt
ggttttgatgatgttcgttatgacgaatctccgattgctcagcagatggctgaggccacc
ggggctcaacaggatctaatgcggctctcaggaaatgagttgtatggccatatggaacaa
acgctttggcataccgaacgcactatttacaacacattggctgtagcgaaatttttgatg
agtcgtcatgtcaatagcgtggattacaaggtggtgatgactggggaaggctccgatgag
ttgtttggtggataccccgccttccggcgcgacatgtttttgcacggtttggatgatctt
ccgaaggaagagcgggaagcctgtgagtgcttgctacaggactccaattcattagtccaa
ggagcgatgttgtctgctgctcaggttgatgaccctgatcttgaggctgtcgtgggtttt
acgcctagctgtttgcaaccttggttggcctgtgtacctcttgtgcccgatttgttggcg
gagcatcatcgtattgccgttgaggggtattccccagggaaggcgattgcggctcagttg
gatggcgatcaactggatggccgtcatgccctcgataaagctcaatatgtatggattaag
acgatgctggaaggtcaaattttgacctggggtggtgatcgggtggatatggccaattcg
atggaagcgcgaccggctttccttgatcaccatctcgcggcggtggctgtgcaagtacct
cctgagcttcggattaaggggaaaacagagaaatacgtcctgagggaagcgatggcgggt
ctcctgcctgatgttctctacaaacgcgagaaatttgcatttatggcacctccggcccat
acagagcctgaaaaatgggcacaaatgcagaacttggcggctgattacctcagtgacgaa
gccattgatgcggcgggtttgctcagcaagagcggtgtgaaagccttgtttgatcgtcac
gacagcccagagacaaccgaggctgatcgggtgcagatggatgcagtgattaaccatctg
cttggtgtgcagatgctgcaccgaatgttcgtagcaaccgatgttccacagcaagcgcgg
caagaagcagagcgcttgggttggcgcattccagtagaggtttaa

DBGET integrated database retrieval system