KEGG   Synechococcus sp. CC9902: Syncc9902_2261Help
Entry
Syncc9902_2261    CDS       T00293                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sye  Synechococcus sp. CC9902
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sye00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sye00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2170218..2171360)
Genome map
AA seq 380 aa AA seqDB search
MIECRCTYAMAIVQSVSADVCIEPIRFQPLGPDVFGRTQPQCLLASIDEAVEPLIDLTNQ
HVVSIQSFSAQTLLQLFRLAAKYESNPDRYIRHNTPLTGKILINAFYEPSTRTRLSFDSA
WHRLGGDSINITDRSTTGIAKGESLEDVAHMFNNYGDCVVLRDSNPEAVVAMSSTLRIPI
INAGNGIDEHPTQAMADLYTILKWRPSLAAPNVAESDRIRIGIIGIPSRMRTVRSLLRIL
AKFPGMVEEVVVIHAPGIENDVSLFDPGQREELLKAGLSLRCATDLRAELPELDVVYINA
IAWVGDSYEVHGGGFRLTRDLPFKPEAIVLHPLARGPELSTCLDDTPHNWYFSQARGAVF
LRMALLTCMVDRADRVMDVV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatgtcgatgcacctatgccatggccatcgtccagtctgtttctgctgatgtg
tgtatagagccgattcggtttcaaccgttgggcccagatgtgtttggtaggacgcagccc
cagtgtttgttggcttcgatcgatgaggctgttgagcccttgattgatttgaccaaccag
catgtggtttcgattcaaagtttctccgcacagaccctcttacagctgttccgtctcgcg
gctaagtacgagagcaatcctgatcgctacatccgacacaacacgcctctaactggaaaa
atcctcattaatgccttttatgagcccagtacaagaacacgtctgtcgttcgatagtgct
tggcaccgcttagggggcgattcaatcaacatcacggatcgaagcacaactggaatcgcg
aagggtgaatcgctcgaggatgttgcccatatgtttaataactatggagattgcgtcgta
ctccgagatagcaatcctgaagccgtcgtggcgatgagttccacgcttcgtattccgatc
attaatgcaggaaatgggattgatgaacatcccacccaggcgatggctgatctctacaca
attttgaagtggagacccagtcttgctgctccgaacgttgcagagtcggatcgaattcgt
attggaattattggcattccatcgagaatgcgaacagttcggtctcttctaaggattctc
gccaaattccctgggatggtagaggaggtggtagtgattcacgcgccgggtatcgaaaat
gatgtttcactcttcgatcccggtcagcgagaagagttgctgaaggctggtttgtctctg
cgttgtgcgactgatttacgcgcggagttgcctgagcttgatgtggtttacatcaacgct
attgcttgggttggtgatagttatgaggtgcatggtggagggtttcgtcttacgcgggat
ctgccgtttaagcccgaggcgattgtgttgcatccgctggcgcgggggcctgaattgagc
acctgcctcgatgacactcctcacaattggtatttcagccaggcccgaggcgctgtgttt
cttcgaatggctctgctcacctgcatggtggatcgagccgatcgtgtgatggatgtggtc
tga

DBGET integrated database retrieval system