KEGG   Synechococcus sp. CC9902: Syncc9902_2321Help
Entry
Syncc9902_2321    CDS       T00293                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syncc9902_2321
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syncc9902_2321
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Syncc9902_2321
Enzymes [BR:sye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Syncc9902_2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2233523..2234632
Genome map
AA seq 369 aa AA seqDB search
MVSLFQNLRRRFTANPVMQDWPGLIEAYRDWLPVSAKTPVITLHEGATPLIPVPTIAERI
GKGVRVFVKYDGLNPTGSFKDRGMTMAISKAKEAGCEAVICASTGNTSAAAAAYARRAGM
RAFVLIPDGYVAQGKLAQALVYGAEVLAIRGNFDRALDIVREAADQFPVTLVNSVNPYRL
QGQKTAAFEIVDVLGEAPDWLCIPMGNAGNITAYWMGFQEYHQAGHSRSLPRMMGFQASG
SAPLVYDTTVSDPNTIATAIRIGNPVNRAKAMAVREASDGAFLDVTDEEIINAYKLLGGG
EGIFCEPASAASVAGLLKRKDEVPAGATVVCVLTGNGLKDPDCAINNNDAAFHTDLNPDL
ETVAKVMGF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttggtgtccttgttccagaaccttcgtcggcgtttcacagccaatcctgtgatgcaggac
tggcctggtttgatcgaggcctacagagattggctgcccgttagcgccaaaacaccagtc
atcacgctgcatgaaggggcaacgcccttaattcctgttcccaccattgctgagcgcatc
ggaaagggcgttcgagtcttcgtgaagtacgacggcctcaaccccaccggatcgttcaaa
gatcgcggaatgacgatggcgatcagcaaagccaaagaggctggctgcgaggcggtcatt
tgtgccagtacagggaataccagtgctgcagccgcggcctacgcccgacgggctgggatg
agggccttcgtgttgatccctgatggatacgttgcccaagggaagctggcacaggccctg
gtgtacggagccgaagtgcttgccatccgaggcaattttgaccgtgccctcgacatcgtt
cgtgaagcagcagatcagtttccagtcaccttggtgaactcggtgaatccctatcgacta
caaggacaaaaaaccgctgcattcgaaattgttgatgtcctcggggaggccccggactgg
ctctgcattcccatgggcaatgcaggcaacatcaccgcctactggatgggcttccaggag
taccaccaggccggtcacagccgcagcttgcctcgaatgatgggcttccaggccagtggc
tcagcgcccctggtttacgacaccaccgtgagtgatccaaacaccatcgccaccgccatt
cggattggtaaccccgtcaatcgcgccaaagcgatggctgtacgtgaagccagtgatggg
gcctttctcgacgtgacggatgaggaaatcatcaatgcctacaagcttcttggtggtgga
gaaggaatcttctgcgaaccagccagtgcagcatctgtggccggcctgctcaagcgcaaa
gacgaagttcctgctggagcaacggtggtttgcgtgctcacaggcaatggcctgaaagac
cctgattgcgcgatcaacaacaacgacgctgccttccataccgatctcaatccagatctc
gagacggtggccaaggtgatgggcttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system