KEGG   Synechococcus sp. CC9902: Syncc9902_2321Help
Entry
Syncc9902_2321    CDS       T00293                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syncc9902_2321
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syncc9902_2321
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Syncc9902_2321
Enzymes [BR:sye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Syncc9902_2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2233523..2234632
Genome map
AA seq 369 aa AA seqDB search
MVSLFQNLRRRFTANPVMQDWPGLIEAYRDWLPVSAKTPVITLHEGATPLIPVPTIAERI
GKGVRVFVKYDGLNPTGSFKDRGMTMAISKAKEAGCEAVICASTGNTSAAAAAYARRAGM
RAFVLIPDGYVAQGKLAQALVYGAEVLAIRGNFDRALDIVREAADQFPVTLVNSVNPYRL
QGQKTAAFEIVDVLGEAPDWLCIPMGNAGNITAYWMGFQEYHQAGHSRSLPRMMGFQASG
SAPLVYDTTVSDPNTIATAIRIGNPVNRAKAMAVREASDGAFLDVTDEEIINAYKLLGGG
EGIFCEPASAASVAGLLKRKDEVPAGATVVCVLTGNGLKDPDCAINNNDAAFHTDLNPDL
ETVAKVMGF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttggtgtccttgttccagaaccttcgtcggcgtttcacagccaatcctgtgatgcaggac
tggcctggtttgatcgaggcctacagagattggctgcccgttagcgccaaaacaccagtc
atcacgctgcatgaaggggcaacgcccttaattcctgttcccaccattgctgagcgcatc
ggaaagggcgttcgagtcttcgtgaagtacgacggcctcaaccccaccggatcgttcaaa
gatcgcggaatgacgatggcgatcagcaaagccaaagaggctggctgcgaggcggtcatt
tgtgccagtacagggaataccagtgctgcagccgcggcctacgcccgacgggctgggatg
agggccttcgtgttgatccctgatggatacgttgcccaagggaagctggcacaggccctg
gtgtacggagccgaagtgcttgccatccgaggcaattttgaccgtgccctcgacatcgtt
cgtgaagcagcagatcagtttccagtcaccttggtgaactcggtgaatccctatcgacta
caaggacaaaaaaccgctgcattcgaaattgttgatgtcctcggggaggccccggactgg
ctctgcattcccatgggcaatgcaggcaacatcaccgcctactggatgggcttccaggag
taccaccaggccggtcacagccgcagcttgcctcgaatgatgggcttccaggccagtggc
tcagcgcccctggtttacgacaccaccgtgagtgatccaaacaccatcgccaccgccatt
cggattggtaaccccgtcaatcgcgccaaagcgatggctgtacgtgaagccagtgatggg
gcctttctcgacgtgacggatgaggaaatcatcaatgcctacaagcttcttggtggtgga
gaaggaatcttctgcgaaccagccagtgcagcatctgtggccggcctgctcaagcgcaaa
gacgaagttcctgctggagcaacggtggtttgcgtgctcacaggcaatggcctgaaagac
cctgattgcgcgatcaacaacaacgacgctgccttccataccgatctcaatccagatctc
gagacggtggccaaggtgatgggcttctaa

DBGET integrated database retrieval system