KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0173Help
Entry
Synpcc7942_0173   CDS       T00300                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Synpcc7942_0173
Enzymes [BR:syf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Synpcc7942_0173
Transfer RNA biogenesis [BR:syf03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Synpcc7942_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(172202..173071)
Genome map
AA seq 289 aa AA seqDB search
MSPLQSIAGQPVESVLAIARQVGWEAADIALQFYTAQSEAAPKLWQEGDDPVTAADLAIH
RHVLERLQTAFADQPFGYLSEESDRTALTLPLPEEWVWIIDPLDGTRDFIDHTGEFAVQI
ALTYQQRPVLAVVAIPAQQLLYWAVQGQGCYRETQDGTQTKLTVSDRQEDLILVASRTHR
GDRFQQLLDRLSLPQQIYVGSVGVKIVAIAEQRADVYLSLSGKSAPKDWDMAAPELLLLE
AGGRFSHADGSALRYNTGDISQWGCLIASNGPAHDRLCQEATALLASLD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctctccagtcgatcgccggtcaacccgtcgagtcagttctcgcgatcgcccgt
caagtcggctgggaagcggcagacattgcactgcagttctacaccgctcagtctgaagca
gcaccgaagctgtggcaggagggggatgaccccgtcacggcagcggatttggcaattcat
cgccacgttctggaacggctacaaaccgcttttgccgatcagcccttcggctacctcagc
gaagagagcgatcgcaccgcgctgactttgccactgccggaagagtgggtttggatcatc
gaccccttggatggcacccgcgatttcatcgatcacaccggcgaatttgcggtgcagatt
gccctgacctaccaacagcgcccggtcttggcggtcgtcgcaatacccgctcagcagttg
ctttattgggcggtacaaggccagggctgctaccgcgaaacgcaagacggcactcagacg
aaattgacggtttccgatcgccaagaggatctgattctggttgccagccgaacccatcgg
ggcgatcgcttccagcaattgctcgatcgcctttctttgccgcagcagatttatgtgggc
agtgtcggcgtcaaaattgtcgcgatcgcagaacaacgcgccgatgtttacctctctctc
tcgggtaaatcagccccgaaagattgggacatggccgcccccgagctactcctgctcgaa
gccggtgggcgcttcagccatgccgatggttctgctcttcgctacaacaccggcgatatc
agccagtggggttgcttgattgccagcaacggtcccgcccacgatcgcctctgtcaagaa
gccaccgcactccttgccagcttggactag

DBGET integrated database retrieval system