KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0173Help
Entry
Synpcc7942_0173   CDS       T00300                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:syf00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(172202..173071)
Genome map
AA seq 289 aa AA seqDB search
MSPLQSIAGQPVESVLAIARQVGWEAADIALQFYTAQSEAAPKLWQEGDDPVTAADLAIH
RHVLERLQTAFADQPFGYLSEESDRTALTLPLPEEWVWIIDPLDGTRDFIDHTGEFAVQI
ALTYQQRPVLAVVAIPAQQLLYWAVQGQGCYRETQDGTQTKLTVSDRQEDLILVASRTHR
GDRFQQLLDRLSLPQQIYVGSVGVKIVAIAEQRADVYLSLSGKSAPKDWDMAAPELLLLE
AGGRFSHADGSALRYNTGDISQWGCLIASNGPAHDRLCQEATALLASLD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctctccagtcgatcgccggtcaacccgtcgagtcagttctcgcgatcgcccgt
caagtcggctgggaagcggcagacattgcactgcagttctacaccgctcagtctgaagca
gcaccgaagctgtggcaggagggggatgaccccgtcacggcagcggatttggcaattcat
cgccacgttctggaacggctacaaaccgcttttgccgatcagcccttcggctacctcagc
gaagagagcgatcgcaccgcgctgactttgccactgccggaagagtgggtttggatcatc
gaccccttggatggcacccgcgatttcatcgatcacaccggcgaatttgcggtgcagatt
gccctgacctaccaacagcgcccggtcttggcggtcgtcgcaatacccgctcagcagttg
ctttattgggcggtacaaggccagggctgctaccgcgaaacgcaagacggcactcagacg
aaattgacggtttccgatcgccaagaggatctgattctggttgccagccgaacccatcgg
ggcgatcgcttccagcaattgctcgatcgcctttctttgccgcagcagatttatgtgggc
agtgtcggcgtcaaaattgtcgcgatcgcagaacaacgcgccgatgtttacctctctctc
tcgggtaaatcagccccgaaagattgggacatggccgcccccgagctactcctgctcgaa
gccggtgggcgcttcagccatgccgatggttctgctcttcgctacaacaccggcgatatc
agccagtggggttgcttgattgccagcaacggtcccgcccacgatcgcctctgtcaagaa
gccaccgcactccttgccagcttggactag

DBGET integrated database retrieval system