KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0221Help
Entry
Synpcc7942_0221   CDS       T00300                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Synpcc7942_0221 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_0221 (glk)
   00052 Galactose metabolism
    Synpcc7942_0221 (glk)
   00500 Starch and sucrose metabolism
    Synpcc7942_0221 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Synpcc7942_0221 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Synpcc7942_0221 (glk)
   00524 Butirosin and neomycin biosynthesis
    Synpcc7942_0221 (glk)
Enzymes [BR:syf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Synpcc7942_0221 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
221498..222535
Genome map
AA seq 345 aa AA seqDB search
MTLLLAGDIGGTKTNLMLAIASDCDRLEPLHQASFASAAYPDLVPMVQEFLAAAPSAEVR
SPVVACFGIAGPVVHGTAKLTNLPWQLSEARLAKELGIAQVALINDFAAIAYGLPGLTAE
DQVVVQVGEADPAAPIAILGAGTGLGEGFIIPTAQGRQVFGSEGSHADFAPQTELESELL
HFLRNFYAIEHISVERVVSGQGIAAIYAFLRDRHPDQENPALGAIASAWQTGGDQAPDLA
AAVSQAALSDRDPLALQAMQIFVSAYGAEAGNLALKLLSYGGVYVAGGIAGKILPLLTDG
TFLQAFQAKGRVKGLLTRMPITIVTNHEVGLIGAGLRAAAIATQP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgctattggccggggatatcggcggaaccaaaacgaatttaatgttggcgatc
gcctctgattgcgatcgtttagaaccgctccatcaggccagttttgccagtgcggcctac
cctgatttagtgccgatggtgcaggagtttttggctgccgcaccctccgccgaggtgcga
tcgccagttgtggcttgttttggcattgccggccccgttgtccatggaaccgcgaagctg
acgaacctgccttggcagctctctgaagcgcggctggcgaaggaattgggcattgcgcag
gtggcgttgatcaatgattttgctgcgatcgcctacggcctacccggcttgaccgccgaa
gatcaagtcgttgtgcaagtcggtgaagccgatccggcggctccgatcgccattctgggg
gcaggaactggcttgggcgaaggcttcatcattcccacagcccaaggccgccaagtgttt
ggcagcgaaggttctcacgctgactttgcgccgcaaaccgaactggagtccgagttactg
cattttctacgcaatttttacgcaatcgagcatatctcggtcgagcgagtggtctccggc
caagggattgcagccatctacgccttcctgcgcgatcgccatcccgaccaagaaaatcca
gcccttggggcgattgcctcggcttggcaaacgggcggcgaccaagcccctgatctggca
gcagccgtatcccaagcagccttgagcgatcgcgatccgctggccctacaagccatgcag
atatttgtcagtgcttacggggcggaagccggcaacctcgcgttgaaattgctctcctac
ggcggggtctacgtcgccggcgggattgcgggcaaaatcctgccgctcttgactgatggc
acttttctgcaagccttccaagccaagggacgggtgaaggggctgctgacgcggatgcct
atcacgatcgtcacgaaccacgaagtcgggctgatcggggctggactgcgggcggctgcg
atcgctactcaaccatga

DBGET integrated database retrieval system