KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0272Help
Entry
Synpcc7942_0272   CDS       T00300                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Synpcc7942_0272
Enzymes [BR:syf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Synpcc7942_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
267889..268683
Genome map
AA seq 264 aa AA seqDB search
MAEQPLIGKTILTTRAAGQSSPFAAQLRAAGAAVIEMPTLEIGPPSSWLPLDEAIAAIAD
FDWLILASANAVEAVQQRLAAQQKSWSDVPCAIAVVGQKTAQVLAAQGGKADYIPPEFIA
ESLVEHFPQPVAGQRLLFPRVETGGREQITQALQSQGAIVVEVPAYESRCPSQIPDDALI
ALRQAHLNLISFTSSKTVRNFCQLMASNLGVDWSARISGVAIASIGPQTSITCQELLGRV
EVEAQEYTLDGLLLAIEQWARQTT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagccgctgatcggtaaaaccattttgacgacgcgagccgcggggcaatct
tcgccctttgccgcacaactgcgggccgctggcgcagccgtgatcgagatgccgacccta
gaaatcgggccgcctagctcttggctgcctctagatgaggcgatcgcggcgatcgcagac
tttgattggctgattttggcctccgccaatgccgttgaagccgtgcaacagcggttagct
gcacagcaaaaaagctggagcgatgttccctgcgcgatcgcggttgtcggtcagaaaacc
gctcaagttctcgctgctcaaggtggtaaggcagattacatcccgccggaatttattgct
gagtcgttggttgaacattttcctcagcctgttgccggtcaacgattgcttttcccacgc
gttgaaaccggcggccgtgagcagattactcaagccctgcagtcgcaaggtgcgatcgtg
gtggaagtgcccgcctacgagtcgcgatgtcccagtcagattcccgatgatgccttgatt
gccttgcggcaggcgcatttgaacttgattagcttcaccagttccaaaacggtgcgcaac
ttctgtcagttgatggcgtcgaatctcggcgtggactggtcagcccgcatctcgggtgtg
gcgatcgcttccatcggtccccagacttcgatcacctgtcaggaactcttgggtcgcgtc
gaagttgaggcacaggagtacactttggacggcctattgttggcgatcgaacaatgggcg
cgccaaaccacgtaa

DBGET integrated database retrieval system