KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0310Help
Entry
Synpcc7942_0310   CDS       T00300                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00900  Terpenoid backbone biosynthesis
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01130  Biosynthesis of antibiotics
Module
syf_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Synpcc7942_0310
Enzymes [BR:syf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Synpcc7942_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABB56342
JGI: Syn_pcc79420310
CyanoBase: Synpcc7942_0310
CYORF: Synpcc7942_0310
UniProt: Q31RH7
Position
complement(309473..310417)
Genome map
AA seq 314 aa AA seqDB search
MKTLTLVAPAKINFYLEILGDRPDGFHELAMVMQSIALGDRLHLRQRQGQGFQLGCDRAD
LEVDERNLILKAAQRLQRSFPQIGGVDFFLEKRIPIGAGLAGGSTDGAAALVGLDIFSGL
GLTQPELEAIAAELGSDMPFCVAGGTQLCTSRGEQLTPLPPLPSLSLVLAKFESLSVSTP
WAYGRYREQFGDRYLQTEPARRDRLQALHAGPLLQAMSAGDPVAIAQHLRNDLEAVVLPE
YPQVAELRSVLGNCSGILAAQMSGSGPSVFGIAENPTAAQAAVEQVRQAIADPDLKLWVT
QTISHGIQTETLLR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgctgacgctcgttgctccagccaaaatcaatttctatctggaaattctgggc
gatcgccccgacggtttccacgagctggctatggtgatgcagagcattgccttgggggat
cgtcttcacctacggcagcggcagggacaggggtttcagttgggctgcgatcgcgctgat
ttggaagttgatgagcgcaacttgattctgaaagcagcacagcggttgcagcgatcgttc
ccccaaattggcggcgttgacttttttctcgagaagcggattcccattggtgcagggcta
gcgggcggttcaaccgacggagctgccgctctcgtggggctggatattttcagtgggctg
ggtctgacacaaccagaactggaagcgatcgccgcagaattagggtccgatatgcccttc
tgtgttgccggtggtacccagctttgcaccagtcgcggtgaacaactgacgccgttaccc
cccctaccctctttatccttagtccttgctaagttcgaaagcttgtcggtctcgacgccg
tgggcttacggtcgctaccgcgagcagtttggcgatcgctatctacaaaccgaaccagcg
cggcgcgatcgcctgcaagcgctgcatgccgggccacttctgcaagcgatgagcgctggt
gatcccgttgcgatcgcgcaacatcttcgcaacgatctcgaagcggtggtcttacccgag
tacccccaggtggcggaactgagatctgtgctcgggaactgctctggcattcttgccgcc
caaatgtccggttccgggccaagcgtctttggtattgctgagaatcctactgctgcccaa
gcggccgttgaacaagtccggcaagcgatcgctgatcccgacctgaagctctgggtgacc
caaaccatcagccatgggatccagacggaaactctactgcggtag

DBGET integrated database retrieval system