KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0411Help
Entry
Synpcc7942_0411   CDS       T00300                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00260  Glycine, serine and threonine metabolism
syf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01130  Biosynthesis of antibiotics
syf01230  Biosynthesis of amino acids
Module
syf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Synpcc7942_0411
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Synpcc7942_0411
Enzymes [BR:syf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Synpcc7942_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB FMN_dh ALF NanE Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: ABB56443
JGI: Syn_pcc79420411
CyanoBase: Synpcc7942_0411
CYORF: Synpcc7942_0411
UniProt: Q31R76
Position
complement(402191..402991)
Genome map
AA seq 266 aa AA seqDB search
MTAISDCFAALRSQGRCALIPFLTAGDPDLETTRQALLALDREGADLIELGVPYSDPLAD
GPVIQAAATRALQAGTRLDDVLALLKDVRSQIKAPIVLFTYCNPILNRGFEAFLDQIAAA
GANGLVVPDLPLEESQRLSEVAAERGIDLILLIAPTSSADRIAAISKQARGFIYLVSVTG
VTGMRQGMQSRVADLLQEIRQGTDKPIGVGFGISGAEQARQVRDWGADGVIVGSAFVNRL
QEQGVEGVATLCRELRQAIDRQPVLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaatttctgactgctttgccgccctgcgatcgcagggacgctgtgcattgatc
ccgtttttgacggcgggcgacccggatttagaaaccacccgtcaggcattgctggccctc
gatcgggaaggtgctgacctgatcgagttgggtgtgccctactctgatccgctggctgac
gggcccgtgattcaagcagcagcaacgcgtgccctgcaagcggggacgcgactggatgat
gtcttggcactgctcaaggacgtgcgatcgcagatcaaagcgccgattgtgctgtttacc
tattgcaacccaattctgaaccgcggcttcgaagccttcttggatcagatcgcggcagct
ggcgcgaatggtttggttgtacccgatctgcccttggaagagtcccaacgtctctcagaa
gtcgcagctgagcgtggcattgatttgattctgctgattgcaccgacgagttccgctgat
cgcattgcagcgattagtaagcaggctcgtggctttatctaccttgtcagcgtcaccggt
gtcactgggatgcgccaagggatgcagtcccgtgttgcggatctcctgcaagaaattcgc
caagggactgataagccgatcggggttggcttcgggatttcgggagcagagcaagctcga
caagtgcgcgattggggcgccgatggtgtgatcgttggcagcgccttcgtgaatcgcctg
caagagcagggcgtggaaggggtggccacactctgtcgggaactacggcaggcgatcgat
cgccaacccgtcctgtcctaa

DBGET integrated database retrieval system