KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0583Help
Entry
Synpcc7942_0583   CDS       T00300                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
564123..565217
Genome map
AA seq 364 aa AA seqDB search
MTATLPTAPRRTVFPFTAIVGQEEMKLALLLNVIDPKLGGVMIMGDRGTGKSTTIRALAD
LLPEIEVVAEDPYNSHPSDPELMSNEVRDRIARGETPTIGRAKVQMVDLPLGATEDRVCG
TIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGV
SIRHPARFVLVGSGNPEEGELRPQLLDRFGMSVEVRTVKDPELRVQVVEQRSTFDQNPQT
FLDRYASEQDSLQARIVAAQTLLPSVELDYDLRVKISEVCSELDIDGLRGDIVTNRAAKA
LTAFEGRSEVTLEDIQRIVAPCLRHRLRKDPLESVDSGGKVAKVFCRVFGLPEPTDTSAF
SLVS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcgactcttccgactgcgccacgccgcactgttttccccttcacggcgatcgtc
ggccaggaggagatgaagcttgccctgctgctgaatgtgatcgaccccaaattgggcggg
gtgatgatcatgggcgatcgcggtactgggaaatcaaccacaattcgtgccttggctgac
ctactgcccgaaattgaggtggtggcagaggatccctacaacagccatcccagcgatcca
gagctgatgagtaatgaggttcgcgatcgcattgcccgtggcgaaaccccgacgattggt
cgcgccaaagtacaaatggtcgacctgcctttgggtgcgacggaagatcgcgtctgcggc
acgattgacatcgaaaaagcgctgtcggaaggcgtcaaagcctttgaaccgggtctactc
gcaaaagccaatcgtggcattctctacgtcgacgaagtcaacctgctcgacgatcatttg
gtagatgtgctgctggactcggcggcttctggttggaatacggtggaacgggaaggcgta
tcgattcgccaccctgctcgcttcgtcttggttggttccggtaaccccgaggaaggtgaa
ctgcggcctcagttgcttgatcgcttcggtatgagtgtcgaagtgcgcactgtcaaagat
ccggaactgcgggttcaggtcgtagaacagcgatcgaccttcgatcaaaatcctcagact
ttcctcgatcgctatgccagcgagcaagatagcctgcaagcacggattgttgcagcgcaa
acgctgctgccatccgttgagctggactatgacctgcgggtgaaaatctcggaggtctgc
tcggagctggatattgacggcctgcggggtgacatcgtcaccaaccgcgctgccaaagcg
ctgacggcctttgaagggcggtcggaagtcaccctcgaagatattcagcggatcgttgcc
ccctgtctgcggcaccgcctccgcaaggatccgctagagtctgtggactcggggggcaaa
gtggcgaaagtcttctgccgtgtctttggcctgccggagccgaccgacaccagtgccttc
tctctggtcagctaa

DBGET integrated database retrieval system