KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0592Help
Entry
Synpcc7942_0592   CDS       T00300                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Synpcc7942_0592
   01230 Biosynthesis of amino acids
    Synpcc7942_0592
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_0592
   00030 Pentose phosphate pathway
    Synpcc7942_0592
   00051 Fructose and mannose metabolism
    Synpcc7942_0592
   00052 Galactose metabolism
    Synpcc7942_0592
  Energy metabolism
   00680 Methane metabolism
    Synpcc7942_0592
Enzymes [BR:syf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Synpcc7942_0592
Protein phosphatases and associated proteins [BR:syf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Synpcc7942_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(579312..580394)
Genome map
AA seq 360 aa AA seqDB search
MAVRKLGVLTSGGDCPGLNAVIRAIARHAVGNYGWELWGIAYATQGLLKRQAIALSPHHF
DRQSLDPLLCSGGTILGSINRGDTLAHQAEILAGYQELGLDALIGIGGDGSLAILRQLAE
AGRWQFIGIPKTIDNDVALTERAIGFDTAIHTVAEALLSLGSTAASHDRIMIAEVMGRQS
GHLALQGGIAGGADVILLPEIPYRLLELCHYLQQLRDRWQRRYAVIAIAEGTHHPPEVTQ
GPGSLGEQLVQAITAQDPTLDARVTVLGHVQRGGNPVASDRLLATQMGYAAVERLAAGAS
GEMMAWQGGRVVSVPLEAVCLQSPTLVDPHSPLVDTAAGLGIFLGDRSLTPWRGSACPTH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcgcaagttaggcgttctcaccagtggcggcgattgcccaggcctcaatgct
gtgattcgagcgatcgcccgtcatgccgttggcaattacggctgggagctctgggggatt
gcctacgccactcaagggctcctcaagcggcaagcgatcgccctgtccccccaccacttc
gatcggcagagtcttgacccgttgctctgcagcggtggcaccatcctcgggtccatcaat
cggggcgatacccttgcccaccaagccgaaattctggctggctatcaggaacttggcttg
gatgccctgattggcattggcggcgatggcagtctggccattctgcggcagctagccgaa
gcgggtcgttggcagttcatcggcatcccaaaaaccatcgacaacgatgtagcgctgact
gagcgggcgatcgggtttgataccgccattcacaccgttgcggaagccctgctgagtttg
ggcagcacagcagccagccacgatcgcatcatgattgccgaggttatgggtcgccagtcg
gggcatttggccctacagggcggcattgccggaggcgccgacgtcattctcttgccagaa
attccctatcgactgctggagctctgtcactacttacagcaactgcgcgatcgctggcag
cgtcgctatgccgtgattgcgatcgcggaaggcacccatcatccccccgaggtcactcaa
ggacctggcagcttgggcgaacaattggttcaggcaatcaccgcccaggatccgacatta
gatgcccgtgtcaccgtcttgggtcatgtgcagcgcggtggtaaccccgtagcgagcgat
cgccttttggctactcagatgggctacgccgctgtagaacggcttgccgcaggtgcctcc
ggcgaaatgatggcttggcagggcgggcgggttgtcagcgttccgctcgaagccgtctgc
ctccaaagccctaccttggttgatcctcacagtccgctcgtcgataccgctgcagggctg
ggaatttttctgggcgatcgcagtctgactccttggcggggttcagcgtgccccacccat
tga

DBGET integrated database retrieval system