KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0608Help
Entry
Synpcc7942_0608   CDS       T00300                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Synpcc7942_0608
Enzymes [BR:syf01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Synpcc7942_0608
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Synpcc7942_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
595756..596298
Genome map
AA seq 180 aa AA seqDB search
MTVLTIYREDLPEQPLTQTTDAAEIAALLAQQGLRFERWPAQVELADDATPEQILAAYAT
EVDRVKTEGGYITVDAVSLRPDHPDRAALRQKFLAEHIHSEDEVRFFVAGQGLFSLHLGD
HVYALLCTQNDWISVPAGTRHWFDMGSQPYFTALRFFNNPEGWVAQFTGSDIASQFPLLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcctaacgatctatcgcgaagatctgcctgaacagcctttgacccaaaccacg
gacgcggctgaaattgcagccttgcttgctcaacaaggactgcggtttgaacgctggccg
gctcaggtggagttggctgatgatgcgacgccggagcagattttggcggcctatgcgacg
gaagtcgatcgcgtcaaaaccgaaggcggttacatcaccgttgatgcggttagcctgcgc
cccgatcatcccgatcgcgctgctcttcgccagaagtttttggcagaacacatccatagc
gaagacgaagttcgcttttttgttgcaggacaaggcttgttctcgctgcacctaggcgat
cacgtctatgccctactctgcacccaaaatgactggatcagcgttccggctggaacgcgc
cactggtttgatatgggcagtcagccctacttcacggctctgcgtttctttaacaatccc
gaaggctgggtcgctcagtttaccggcagcgacatcgccagtcagttcccgctcctgccc
tga

DBGET integrated database retrieval system