KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0670Help
Entry
Synpcc7942_0670   CDS       T00300                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:syf00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:syf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
665121..666137
Genome map
AA seq 338 aa AA seqDB search
MSDWQRRHILSLADFSPVEYEMVLRTAAGFAEVLQRRNKKVPTLQGQVVTTLFFEPSTRT
RSSFELAAKRLSADTINFAASSSSLSKGETILDTARTYLAMGSDIMVVRHAQAGVPQAIA
REMERLGTEVRVLNAGDGQHEHPSQALLDLFTICSVIQPEQPSLGAIAGKKIAIVGDILH
SRVARSNIWSLTAAGAEVHLAAPPTLLPPEFAQFANTPIPGSGLPRQLQIHWQLESALEN
ADFVMTLRLQQERMSQSLLPSLREYHREFGLTRDRLRVCQPSVKLLHPGPVNRGVELSSD
LMEDESISLIQPQVTNGVAVRMALLYLIGAAVPAAIPA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgattggcaacgtcgacacattctgtcgttagcagactttagccctgtcgaatat
gaaatggtgttgcgtacagcggcgggctttgctgaggttctgcagcggcgtaataaaaaa
gtgccgaccttgcagggacaggtggtaacgacgctgttttttgagccatcgacgcggaca
cgcagcagctttgaactggcggcaaaacggctatcggcagacacgattaactttgcggcc
agcagttcatcgctcagcaagggcgagactattctcgatacggcccgcacctatctggcg
atgggcagtgacattatggtggtgcgccatgctcaggccggcgttccccaggcgatcgcg
cgggaaatggaacggctcggcaccgaggtgcgggtactcaatgccggtgacggtcagcac
gagcatccctcgcaagcgctgttggatttgttcacaatctgcagtgtgattcagccggag
caaccgagtctgggtgcgatcgcgggcaagaaaattgcgatcgtcggcgatatccttcac
tcgcgggtggcacgatcgaacatttggagcctgacggcggccggggctgaggtgcattta
gccgctccaccgacgttattgcctccagagtttgcccagtttgctaataccccaattcct
ggcagtggattgccgcgccagctccagattcactggcaactagagtccgcattggaaaac
gctgattttgtgatgactctgcgcctgcaacaggagcggatgagtcagtcgctcctgccg
agtttgcgggaatatcatcgggagtttggcctaacgcgcgatcgcctgcgggtctgccag
ccaagcgtgaaactcctccatcccgggccggtcaaccgaggcgtggaactcagctctgac
ctgatggaagacgagtcgatcagtctgattcagccgcaagtcaccaatggagttgctgtc
cgcatggctttgctgtacctgattggggcagcggtacccgctgcaattccggcctag

DBGET integrated database retrieval system