KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0715Help
Entry
Synpcc7942_0715   CDS       T00300                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00520  Amino sugar and nucleotide sugar metabolism
syf00550  Peptidoglycan biosynthesis
syf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Synpcc7942_0715
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Synpcc7942_0715
Enzymes [BR:syf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Synpcc7942_0715
Peptidoglycan biosynthesis and degradation proteins [BR:syf01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Synpcc7942_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABB56747
JGI: Syn_pcc79420715
CyanoBase: Synpcc7942_0715
CYORF: Synpcc7942_0715
UniProt: Q31QC2
Position
709992..711179
Genome map
AA seq 395 aa AA seqDB search
MAGALLCPDQCRIRNVPQLADVGRMLEILEALGVKTQQQGDCIDLDLRDLSSPAAPYELV
NQLRASFFAIGPLLARVGVARMPLPGGCNIGARPVDLHVRGLRALGAHVQIEHGIVSAAI
PGSRRRLQGARIYLDCPSVGATETLMMAAVLAEGETILENAAQEPEVVDLANFCRAMGAR
IRGAGTNTISIQGVERLHTADYAIIPDRIEAGTFLIAGAITNSVINVAPVIPDHLSATIA
KLEEMGCPIVQTSSNELQTQPQGSLRGVDLRTLPYPGFPTDMQAQFMALMSICEGDSVIT
ETVFENRMQHVAELQRMGADIRLQGNTAIVRGVPQLSGAPVLATDLRASAALILAALAAE
GKTQISGLQHLDRGYENIEEKLRKLGADIKRFTAE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctggagcgctgctttgtcctgaccaatgccggattcgcaatgttccgcagctggct
gacgtgggccgcatgctggagattctggaggcattgggcgtcaaaacccagcaacagggc
gactgtattgatctcgatctgcgggatctcagcagtccggctgctccctacgagctcgtt
aatcagctgcgcgccagcttttttgcgatcggtccgctcttggcacgggtaggggtagct
cgcatgccactgcccggtggctgcaacattggggcgcgtccggtggatctgcatgtgcgt
ggcctccgtgcgttgggtgcccacgtccaaattgagcatggcattgtcagtgctgcaatt
cccggctcacgccgtcgcctgcaaggcgcgcggatctatctcgactgccccagtgtcggc
gcaactgaaaccctgatgatggcagctgtgctggcggaaggggaaaccatcctcgagaat
gctgcgcaagaaccagaagttgtggatttggccaacttctgtcgcgcgatgggggctcgt
attcgcggagctggtaccaacaccatctccatccaaggggtggagcgactgcacacggcg
gactacgcgatcatccccgatcgcattgaggcaggcacttttctgatcgctggggcaatc
actaactcggtaattaatgtcgcgccggtaattcccgatcacctctcggctacaatcgcc
aagcttgaggaaatgggctgtccgatcgtccagaccagcagcaacgagctccagacccaa
ccccagggcagcttgcgaggggttgacctacggacacttccctatccgggcttccccaca
gatatgcaggcgcaatttatggcgttgatgagcatttgtgaaggggatagcgtgatcacc
gagacggtgtttgagaaccgaatgcagcacgtggctgaactgcagcgcatgggtgcagac
atccgtttgcaaggcaatacggcgatcgtccggggcgtaccgcagctctcgggggcaccg
gtgctggctaccgatctgcgggcttctgcggctctgatcttggcggccttagcagcggag
ggcaaaacccaaatcagcggcctgcagcacctcgatcgcggctacgaaaacattgaggaa
aaacttcgcaagttaggcgctgatatcaagcgctttacggcagaatag

DBGET integrated database retrieval system