KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0715Help
Entry
Synpcc7942_0715   CDS       T00300                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Synpcc7942_0715
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Synpcc7942_0715
Enzymes [BR:syf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Synpcc7942_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
709992..711179
Genome map
AA seq 395 aa AA seqDB search
MAGALLCPDQCRIRNVPQLADVGRMLEILEALGVKTQQQGDCIDLDLRDLSSPAAPYELV
NQLRASFFAIGPLLARVGVARMPLPGGCNIGARPVDLHVRGLRALGAHVQIEHGIVSAAI
PGSRRRLQGARIYLDCPSVGATETLMMAAVLAEGETILENAAQEPEVVDLANFCRAMGAR
IRGAGTNTISIQGVERLHTADYAIIPDRIEAGTFLIAGAITNSVINVAPVIPDHLSATIA
KLEEMGCPIVQTSSNELQTQPQGSLRGVDLRTLPYPGFPTDMQAQFMALMSICEGDSVIT
ETVFENRMQHVAELQRMGADIRLQGNTAIVRGVPQLSGAPVLATDLRASAALILAALAAE
GKTQISGLQHLDRGYENIEEKLRKLGADIKRFTAE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctggagcgctgctttgtcctgaccaatgccggattcgcaatgttccgcagctggct
gacgtgggccgcatgctggagattctggaggcattgggcgtcaaaacccagcaacagggc
gactgtattgatctcgatctgcgggatctcagcagtccggctgctccctacgagctcgtt
aatcagctgcgcgccagcttttttgcgatcggtccgctcttggcacgggtaggggtagct
cgcatgccactgcccggtggctgcaacattggggcgcgtccggtggatctgcatgtgcgt
ggcctccgtgcgttgggtgcccacgtccaaattgagcatggcattgtcagtgctgcaatt
cccggctcacgccgtcgcctgcaaggcgcgcggatctatctcgactgccccagtgtcggc
gcaactgaaaccctgatgatggcagctgtgctggcggaaggggaaaccatcctcgagaat
gctgcgcaagaaccagaagttgtggatttggccaacttctgtcgcgcgatgggggctcgt
attcgcggagctggtaccaacaccatctccatccaaggggtggagcgactgcacacggcg
gactacgcgatcatccccgatcgcattgaggcaggcacttttctgatcgctggggcaatc
actaactcggtaattaatgtcgcgccggtaattcccgatcacctctcggctacaatcgcc
aagcttgaggaaatgggctgtccgatcgtccagaccagcagcaacgagctccagacccaa
ccccagggcagcttgcgaggggttgacctacggacacttccctatccgggcttccccaca
gatatgcaggcgcaatttatggcgttgatgagcatttgtgaaggggatagcgtgatcacc
gagacggtgtttgagaaccgaatgcagcacgtggctgaactgcagcgcatgggtgcagac
atccgtttgcaaggcaatacggcgatcgtccggggcgtaccgcagctctcgggggcaccg
gtgctggctaccgatctgcgggcttctgcggctctgatcttggcggccttagcagcggag
ggcaaaacccaaatcagcggcctgcagcacctcgatcgcggctacgaaaacattgaggaa
aaacttcgcaagttaggcgctgatatcaagcgctttacggcagaatag

DBGET integrated database retrieval system