KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0756Help
Entry
Synpcc7942_0756   CDS       T00300                                 

Definition
chain A, D20c mutant of T4 lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
syf  Synechococcus elongatus PCC7942
Brite
Enzymes [BR:syf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Synpcc7942_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
750406..750870
Genome map
AA seq 154 aa AA seqDB search
MSDRIRTIADQLTGERVDLIRQLTLHEGLRLKPYRCTAGRLTIGIGRNLDDRGISEAEAR
LLLVSDIDHAMRQLESRLPWVRQLSWVRQRVLIDMAINLGIDGLLRFRKTLGHIEAGRYA
EAADEMLNSLWADQVGERARRLSRMMGSNQDPFA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgcatccgcacgattgcagaccaacttaccggcgagcgtgtcgacctgatt
cggcagttgaccttgcatgagggcttgcggctgaagccgtaccgctgcacggcgggcagg
ctgacgattggcatcggtcgcaatctggacgaccgcggcatcagtgaggctgaagcgcgg
ttgctgctggtgagcgacatcgaccacgcaatgcgacagcttgagtcgcgcctgccttgg
gttagacagctttcgtgggtgcgtcagcgagtgctgatcgacatggcaattaatctgggt
atcgacggcctgcttcgcttccgtaagaccctaggccacattgaggccggacgctacgcc
gaggcagctgatgagatgctgaacagcctctgggctgaccaggtgggtgagcgtgcccga
cgtctcagccgcatgatgggcagtaatcaagacccgtttgcctag

DBGET integrated database retrieval system