KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0854Help
Entry
Synpcc7942_0854   CDS       T00300                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Synpcc7942_0854
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Synpcc7942_0854
Enzymes [BR:syf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Synpcc7942_0854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
850233..852629
Genome map
AA seq 798 aa AA seqDB search
MTYELPAAAWRRPLGLGWEKPYTVRYASNLDDGPWHGAPLGGFGAGCWGRSPRGDVTLWH
LDGGEHWYGSIPACQFAVYESGTGAYALSTEAPSDGSLSSWNWYPASTAERSTGEYSALY
PRSQFSYQQVFEAEIHCRQFSPILPHDYQATSYPTAIFRWQLHNPSDRPLTISILLSWEN
LCGWFTNTNKAPEVVYRDDGSPVYDYVPALGQSVGNLNQRIAGEGWQGLLLDQTRSQDPE
EGDGQWAIAIAEAEGLEIFRCDRWDPTGDGSELWQSFALDGSIPDRQDSQPAAAGERLAG
AIAVRLTLQPGESREIPFSIAWDLPVTEFAAGVKAFRRYTDFFGRDGRNAAAIAATGLKH
YDEWEQAIAAWQQPILDRDDLSDTFKLGLFNELYDLCSGGSLWTAASEADPVGQFAVLEC
LDYAWYESLDVRLYGAFGLLMLWPELEKAVMRAFARAIPQADDRTRVIGYWFTIGQESPL
AKRKLANATPHDLGAPNESPWLQTNYTGYQDCNLWKDLGCDFVLQVWRDYQLTGSSDRGF
LSDCWPAAVAALRYLKDFDLDGDGIPENSGAPDQTFDDWRLQGISAYCGGLWIAALEAAL
AIADVLELSAEDRDRQDFQSWLAQARSLYHDTLWNGRYYQLDSGSGSQVVMADQLCGDFY
SRLLQLPPVAPLEAAQSTADMVYEACFQKFHSGQFGLANGLLPDGSPVDPKGTHPLEVWT
GINFGIAAYWLLLGHRDRCFEVTETVIRQIYDNGLQFRTPEAITANATFRASHYLRPMAI
WAVYGVLTNFSPVDQQPV
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgacctatgaactgcccgctgctgcctggcgccgaccccttggtctgggctgggaaaaa
ccgtataccgttcgctacgccagcaatctggatgatgggccttggcatggtgcgccgctg
ggcggatttggtgcgggttgttgggggcgatcgccgcgcggcgacgtcacgctctggcat
ttagacggcggcgagcattggtatggcagcattcctgcctgtcagttcgcggtctatgaa
agtggcacgggtgcctacgcgctcagtaccgaagcgccgagcgatggcagcctcagtagt
tggaactggtatcccgccagcacggcagagcgatcgaccggagaatacagcgccctctac
ccacgcagccagttcagctatcagcaggtgtttgaggcagagattcactgccgccagttc
tcgccaattctgccccacgactatcaggcgaccagctatccgaccgcaatttttcgttgg
cagctccacaaccccagcgatcgccccctgacgatcagcattctgctgagctgggaaaat
ctttgtggctggttcaccaacactaacaaagcgccggaagtcgtctaccgggatgatggt
agccctgtctatgactacgttcccgcgttaggccagagtgtaggcaatctcaatcagcgg
attgcaggcgaaggctggcaggggctgctgctggatcaaacgcgatcgcaagatcctgag
gaaggggatgggcaatgggcgatcgccattgctgaggcagaaggactggagattttccgc
tgcgatcgctgggatccgacaggtgacggatcggagttgtggcaatcctttgcgctggat
ggctcaattccagatcgccaggattctcagccggcagcagcgggtgagcgattggcgggt
gcgatcgctgttcggctgacgctacagccgggcgaaagccgcgaaattcccttcagcatc
gcttgggacctgccggtcactgaatttgcggcaggtgtgaaagccttccggcgctatacc
gacttctttgggcgtgacggtcgtaatgcggccgcgatcgccgccacggggctgaagcac
tacgacgagtgggaacaggcgatcgctgcttggcaacaaccgattctcgatcgcgatgac
ctctccgatactttcaagctgggactgttcaacgaactctatgacctctgtagtggcggc
agtttgtggacagcagccagcgaagccgatccagtcgggcagttcgctgttttggaatgc
ctggattacgcctggtacgagagtttggatgtgcggctctacggcgcttttgggctgctg
atgctctggccagagctagaaaaagcggtgatgcgagcctttgcgcgggcgattccccaa
gctgacgatcgcacgcgggtgattggctactggttcacgattggccaagaaagtccgcta
gcgaaacgcaagttggcgaatgcgacgccccatgacttaggcgcaccgaatgagtcgcca
tggttgcagaccaactacaccggctatcaagattgcaacctttggaaggatttgggctgt
gattttgtcctgcaggtctggcgtgattatcaactgactggttcgagcgatcgtgggttc
ctgtcggactgctggccagctgccgtagcggcactgcgctatctcaaggactttgatctg
gatggtgatggcattcccgagaatagcggtgcgccggatcaaacttttgatgattggcgc
ttgcaaggcattagtgcctactgcggtgggctctggattgcagcgctggaggctgctctc
gcgatcgctgatgttttggagttgtcagcagaagaccgcgatcgccaagacttccaatcc
tggctagcacaggcgcgatcgctctatcacgacaccctttggaatggccgctattaccaa
ctcgatagcggcagcggtagccaagtcgtgatggcggatcaactctgcggtgacttttat
agtcggctattgcagttaccgccggtcgctccgctggaagccgcgcaatccacagctgat
atggtctatgaggcttgcttccagaagtttcatagcggtcaatttggtttagccaatggc
ctgctgccagatggttcgccagtagatcccaagggtacgcacccgctggaagtgtggaca
ggaattaactttggcattgctgcctattggttgctgctaggtcaccgcgatcgctgtttt
gaagtgacagagacggtcattcgccaaatttatgacaacggcttacagtttcgtacgccg
gaagcgatcactgccaatgcaacgtttcgcgctagccactatctccggccaatggcaatt
tgggcagtttatggtgtgctaactaacttttctccagttgatcaacaacccgtctag

DBGET integrated database retrieval system