KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1019Help
Entry
Synpcc7942_1019   CDS       T00300                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:syf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1033300..1034799
Genome map
AA seq 499 aa AA seqDB search
MFTRAAGILLHPTSLPGPFGSGDLGPASRQFLDWLATAGQQLWQVLPLGPTGYGYSPYLC
YSALAGNPALISPELLAEDGWLQESDWADCPAFPSDRVDFASVLPYRDQLLRRAYSQFLQ
RAASSDRQLFQAFCEQEAHWLDDYALFMAIKLASQGQPWTEWPEALRQRQPQALAKARDR
WGGEIGFQQFLQWQFREQWLALREEAQARHISLIGDIPIYVAHDSADVWANPQFFALDPE
TGAVDQQAGVPPDYFSETGQLWGNPVYNWAALQADGYRWWLQRLQQLLSLVDYIRIDHFR
GLEAFWSVPAGEETAIDGEWVKAPGADLLSTIRQKLGALPILAEDLGVITPEVEALRDRF
ELPGMKILQFAFDSGAGNAYLPHNYWGRRWVAYTGTHDNDTTVGWFLSRNDSDRQTVLDY
LGAESGWEIEWKLIRLAWSSTADWAIAPLQDVFGLDSSARMNRPGQATGNWDWRFSADWL
TGDRAQRLRRLSQLYGRCR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgtttacacgagccgccggcattttgttacatcccacttcgttgccggggccattcggc
agcggcgaccttggtccggcctcgcggcagtttcttgactggttggcaacggcgggacaa
caactgtggcaagtgttgccccttgggccgacaggctatggctattcgccttacctctgc
tattccgccttggctggcaatcccgctctgatcagccctgaactcttggcagaagatggc
tggctccaagaatcggactgggcagactgtcctgcttttccgagcgatcgcgtcgatttt
gccagcgtcttgccctatcgcgatcaactgctgcgccgtgcctacagccaattcctgcaa
agagcggcttccagcgatcgccaactctttcaagctttctgtgaacaggaagcccattgg
ctggatgactacgccctgttcatggcgattaagctggctagccaaggtcagccttggaca
gaatggccggaagcgctgcgtcagcggcaacctcaagccttggctaaagcccgcgatcgc
tggggcggcgaaattggcttccagcagtttctgcagtggcaatttcgcgagcagtggttg
gccctgcgggaagaagcccaagcccgccatatttcgctgattggcgatattccgatctac
gtcgctcatgacagtgcggacgtttgggccaatcctcagttctttgccctcgatcctgaa
acgggcgcagttgatcagcaggccggtgtgccgcctgactatttctccgaaaccggccaa
ctctggggcaatcccgtctacaactgggctgcgctgcaggcggatggctatcgctggtgg
ttgcaacggctgcaacagctcctcagcttagtggactacattcgcatcgaccacttccgc
ggtttagaggcgttttggtcggttcccgctggtgaagaaacggcgatcgacggagagtgg
gtcaaagccccaggcgctgatctgctgagcacgattcgccaaaaactgggagcgctaccg
attctggcagaggatctcggtgtgattacgccggaggtggaagcgctgcgcgatcgcttt
gagctgccgggcatgaagattctgcagttcgcctttgactctggggccggcaatgcctat
ctaccgcacaactactggggtcgtcgctgggtggcttacaccggcacccacgacaatgac
acgaccgtcggctggttcctgtcccgcaatgacagcgatcgccaaacggtgctggattat
ctgggcgcagagtcgggctgggaaattgagtggaagctgatccgcttggcttggagctcg
acggcagattgggcgatcgcaccgctccaagatgtcttcgggctggatagcagcgcccgc
atgaatcgaccggggcaagccaccggcaactgggactggcgcttcagtgccgactggctg
acgggcgatcgtgcccaacgcctgcggcgactctcgcagctctatggacgctgtagatga

DBGET integrated database retrieval system