KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1068Help
Entry
Synpcc7942_1068   CDS       T00300                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Synpcc7942_1068
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_1068
   00020 Citrate cycle (TCA cycle)
    Synpcc7942_1068
   00620 Pyruvate metabolism
    Synpcc7942_1068
Enzymes [BR:syf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Synpcc7942_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1079478..1080773
Genome map
AA seq 431 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVEWVKAPGDRVEKGETVLIVESDKADMDVESFYEGYLATII
VPAGGNAPVGEAIALIAETEAEIEVAKQQAAGAGSAAATPATPAATAAPEPVAVSPEPVA
APTATRSDRLVASPRAKKLAKSLGVDLASLTGSGPHGRIVAADVEAAAGVTAKPAIATPV
APAVVTAPVAAPVATAPAAPAPTPAIAPGQFVPYSTFQQAVVRNMEASLNVPVFRVGYTI
TTDAIDSLAKQLKPKGVTITVLLAKAVAATLAKHPLLNARATETGVQYNEAINVAIAVAM
DDGGLLTPVLGRADQTDLYSLARNWKDLVARSRTKQLKPEEYTTGTFTLSNLGMFGVDRF
DAILPPGTGAILAIGASKPTLVATADGLFGVKRQMQVNLTCDHRHIYGAHAAAFLKDLAD
LIENRPESLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaagtcttcatgcccgccctcagctccactatgaccgagggcaagatcgtc
gagtgggtgaaggctccgggcgatcgtgtcgagaaaggtgaaacagtcctgatcgtcgag
tcggacaaagccgacatggacgtggaatctttctatgaaggctacctcgcgacgattatt
gtgccggcaggcggcaatgctcccgtgggcgaagcgatcgctctgattgcagaaactgaa
gccgaaattgaagttgcgaagcaacaggcagccggtgctggttccgctgcagcgacccct
gcaacccctgctgctacggcggcacccgaacccgtcgctgtgagccctgaacctgtcgct
gctcctacagcaacccgcagcgatcgcttggttgcctccccgcgtgccaaaaaactcgcc
aagagcttgggcgttgacctcgctagccttaccggcagtggtccccacggtcgaattgtg
gcagccgatgtcgaagccgccgcaggagttactgccaaacccgcgatcgctacccctgtg
gctcctgccgttgtcaccgcaccggttgctgctcccgttgctacggctcctgctgccccc
gcgccaactcccgcgatcgcgccgggtcagttcgtgccctacagcaccttccagcaggcc
gtggttcgcaacatggaagcgagcctcaacgtgccggtcttccgcgtcggttacacgatc
accaccgatgcgatcgatagtttggccaagcagctcaagcccaaaggcgtgacaatcacg
gttttgctggccaaagccgtcgctgcaaccctcgccaagcatcccttgctcaatgctcgg
gcgacagaaactggcgtccagtacaacgaagccatcaacgtggcgatcgcggtggctatg
gatgatggcggtctgctgacccccgtactgggtcgtgctgatcaaaccgatctctatagc
ttggctcgcaactggaaggatctcgtggcgcgatcgcgcaccaagcaactcaaacccgag
gaatacaccaccggcacctttaccctctccaatctagggatgtttggtgtcgatcgcttc
gatgcgattctgccgccgggcaccggtgcgattctggcgattggggcttccaaaccgacc
ctcgtggccacggctgacggtctgtttggcgtcaagcggcagatgcaagttaacctcacc
tgtgatcaccgccacatctacggcgctcatgcggctgccttcctcaaggacttggccgac
ctgattgaaaaccgccccgaaagcctgaccctctaa

DBGET integrated database retrieval system