KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1085Help
Entry
Synpcc7942_1085   CDS       T00300                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Synpcc7942_1085
Enzymes [BR:syf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Synpcc7942_1085
Exosome [BR:syf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Synpcc7942_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1099720..1102044
Genome map
AA seq 774 aa AA seqDB search
MTGTTPLPSSSLSVEQVNRIASNQEQNPFDILGPHPYEHEGQAGWVIRAYLPEAQEAAVI
CPALRREFAMHPVHHPHFFETWVPEETLEIYQLRITEGERERIIYDPYAFRSPLLTDYDI
HLFAEGNHHRIYEKLGAHPCELENVAGVNFAVWAPSARNVSILGDFNSWDGRKHQMARRS
NGIWELFIPELTVGAAYKYEIKNYDGHIYEKSDPYGFQQEVRPKTASIVADLDRYTWGDA
DWLERRRHQEPLRQPISVYEVHLGSWMHASSDAIATDAQGKPLPPVPVADLKPGARFLTY
RELADRLIPYVLDLGYSHIELLPIAEHPFDGSWGYQVTGYYAATSRYGSPEDFMYFVDRC
HQNGIGVILDWVPGHFPKDGHGLAFFDGTHLYEHADSRQGEHREWGTLVFNYGRHEVRNF
LAANALFWFDKYHIDGIRVDAVASMLYLDYNRKEGEWIPNEYGGRENIEAADFLRQVNHL
IFSYFPGALSIAEESTSWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQN
NVTFSIWYAFSENFMLALSHDEVVHGKSNLIGKMPGDEWQKFANLRCLLGYMFTHPGKKT
LFMGMEFGQWAEWNVWGDLEWHLLQYEPHQGLKQFVKDLNHLYRNAPALYSEDCNQAGFE
WIDCSDNRHSIVSFIRRAHESDRFLVVVCNFTPQPHAHYRIGVPVAGFYREIFNSDARSY
GGSNMGNLGGKWTDEWSCHNRPYSLDLCLPPLTTLVLELASGPESLSEAANSPL
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgactggtacgaccccgctcccctccagcagcctatccgtcgagcaggtcaatcgcatt
gccagtaatcaagagcaaaatcctttcgatattctgggccctcatccctacgagcacgaa
ggtcaagccgggtgggtgattcgcgcctatctacccgaggcgcaagaagctgctgtgatc
tgtccagccttgcgccgcgaatttgcgatgcacccggtgcatcatccccatttttttgag
acttgggtcccagaagagactctggagatctatcaactgcgcattacagagggagaacgc
gagcggattatctacgatccctatgccttccgatcgcccttgctgacggactatgacatc
cacctgtttgcagagggtaatcaccaccgcatctacgaaaaactgggggctcacccctgc
gagcttgaaaacgtggctggcgttaacttcgccgtttgggctcccagtgcccgtaatgtc
tccattctgggtgatttcaatagctgggatggccgcaagcatcagatggcgcggcgcagc
aatggcatctgggaactgttcattcccgaactcacggtaggtgctgcctacaagtacgag
atcaaaaactacgacggtcacatctacgaaaaaagtgacccctatggtttccagcaggaa
gttcgtcccaagactgcatcaattgttgccgatctcgatcgctacacctggggggatgcg
gattggctggaacgccgccggcatcaagagcccttgcggcagccgatctcggtctatgaa
gtgcaccttggctcgtggatgcatgccagttcagatgcgatcgcgacggacgctcaaggc
aagccactaccaccggtccccgttgccgatctcaagccaggggcccgcttcctcacctat
cgggaattggccgatcgcctgattccctacgtgctcgatctgggctatagccacatcgag
ctgctgccgatcgcagaacatcccttcgatggttcttggggctatcaggtcaccggctac
tatgccgccaccagtcgctacggcagccccgaagacttcatgtacttcgtcgatcgctgc
catcaaaacgggatcggcgtcattctcgactgggtgcccggccacttccccaaagacggc
catggcctcgccttcttcgatggcacccacctctatgagcacgccgactcacgccaaggc
gagcaccgcgaatggggcaccctggtcttcaactacggtcgccacgaagtgcgcaacttc
cttgcagccaatgccctgttttggttcgacaagtaccacatcgatggcattcgggtcgat
gccgtcgcctcgatgctctacctcgactacaaccgcaaggaaggtgagtggatccccaat
gagtacggtgggcgcgaaaacattgaagcggcggacttcctgcgccaggtcaaccacctg
atcttcagttacttccccggtgcactgtcgatcgcagaagaatcgacgtcctggccaatg
gtctcttggcccacctatgtcggcggcttgggcttcaacctcaagtggaatatgggctgg
atgcacgacatgctggactacttcagcatggatccttggttccgccagttccaccaaaac
aacgtcaccttcagcatttggtacgccttcagtgagaacttcatgctggcgctcagccac
gacgaagtcgtccatggcaaaagcaatctgattggcaaaatgcccggcgatgaatggcag
aagttcgccaacctccggtgcctgttgggctacatgttcacccaccctggtaagaagacc
ctattcatgggcatggagttcggtcagtgggcggagtggaatgtctggggcgatctggag
tggcacctgctccagtacgaaccccatcagggtctgaaacaattcgttaaagacctcaat
cacctctatcgcaatgcgcccgcactctacagcgaggactgcaatcaagccggttttgag
tggattgactgtagcgacaatcgtcacagcatcgtctcgtttattcgccgcgcccacgag
agcgatcgcttcttggtggtggtctgtaatttcacaccccagccccatgcccactaccga
attggggtaccggttgccggtttctaccgcgagatctttaacagtgatgcccgctcctac
ggcggcagcaacatgggtaatctgggtggcaaatggactgatgaatggtcttgccacaat
cggccctattcccttgatctctgtctgccaccgctgacgaccctcgtgcttgaactggcc
tctggcccagaatccctgagtgaggctgccaacagtcccctataa

DBGET integrated database retrieval system