KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1261Help
Entry
Synpcc7942_1261   CDS       T00300                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Synpcc7942_1261 (tpiA)
   01230 Biosynthesis of amino acids
    Synpcc7942_1261 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_1261 (tpiA)
   00051 Fructose and mannose metabolism
    Synpcc7942_1261 (tpiA)
   00562 Inositol phosphate metabolism
    Synpcc7942_1261 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Synpcc7942_1261 (tpiA)
Enzymes [BR:syf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Synpcc7942_1261 (tpiA)
Exosome [BR:syf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Synpcc7942_1261 (tpiA)
  Exosomal proteins of bladder cancer cells
   Synpcc7942_1261 (tpiA)
  Exosomal proteins of melanoma cells
   Synpcc7942_1261 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1284223..1285014)
Genome map
AA seq 263 aa AA seqDB search
MGEVRRHLKLVNGLARSEQSAVRRIIIAGNWKMYKTQAEALEFLQAFLPQLSETPESRKV
VLCAPFTTLSSLSKTLHGSRVRVGAQNIHWAKEGAFTGEISGAMLTEIGVRYVVVGHSER
RQYFGETDETVNQRLLAAQSFGLLPILCVGESKQQRDAGETEAVISRQLERGLVGADQTN
LVIAYEPIWAIGTGDTCAAEEANRVIGLIRSQLKDTDVPIQYGGSVKPENIDEIMAQPEI
DGALVGGASLEAESFARIVNYQS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgggagaagtccggcgacatcttaaactggtgaacggtcttgcaaggagcgaacagtca
gccgtgcgtcggatcatcattgccgggaactggaaaatgtacaaaacccaggccgaagcc
ctggagttcttgcaagcctttttgccacagctcagcgaaacgccagaatcgcgcaaagtt
gtgctctgtgcacccttcacgaccctgtctagcctgagcaaaaccctccacggcagccgg
gtgcgcgtgggtgctcaaaacattcactgggccaaggaaggggctttcactggcgaaatc
tcgggagcaatgctgacggagattggcgttcgctatgtagtggttggtcacagtgagcgc
cgtcagtacttcggggaaacagatgaaaccgtcaaccagcgcttgctggcagcccaatcc
ttcggtctgttaccgattctctgcgtgggtgagtcgaagcaacagcgcgatgctggtgag
actgaagccgtgatcagtcgtcagttggagcgtgggttggtcggtgccgatcaaaccaac
ttggtgattgcctacgaaccgatctgggcgatcgggactggtgatacctgtgcagccgag
gaagctaatcgcgtcattggcctgattcgcagtcagctcaaggatactgatgtgccgatc
cagtacggtggttcggtcaaacctgagaacatcgacgagatcatggcgcagccagaaatt
gatggagccttggtcggcggtgctagcctcgaagctgagagtttcgcccgcatcgtcaat
taccagagctaa

DBGET integrated database retrieval system