KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1323Help
Entry
Synpcc7942_1323   CDS       T00300                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:syf00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Synpcc7942_1323
Enzymes [BR:syf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Synpcc7942_1323
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Synpcc7942_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1351949..1352797
Genome map
AA seq 282 aa AA seqDB search
MPELPEVETVRRGLTQQTLQRVCTGGEVLLSRTIATPTPELFLVALQQTQIQEWRRRGKY
LLADLSREGEPAGTWGVHLRMTGQFFWTEPATPLTKHTRVRLRFEGDRELRFIDIRSFGQ
MWWVPPDRPVESVITGLSKLGPEPFAPEFTARYLRDRLRRSQRPIKTALLDQSLVAGIGN
IYADESLFRTGIHPTTPSDRLTKIQAEKLREAIVEVLTASIGAGGTTFSDFRDLTGVNGN
YGGQAWVYGRKDQPCRTCGTPIQKLKLAGRSSHFCPRCQPCS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaactgcccgaagtcgaaactgtccgccgtggactgactcaacaaaccctgcaa
cgcgtttgcacaggtggcgaagtcttactctctcgtacgatcgcgacacccacgcccgaa
ctgttcctcgtggcgctgcagcagacccaaattcaggaatggcgacgccgtggcaaatat
ttgttagctgacctcagtcgtgagggagagcctgcaggaacttggggcgtgcatctgcgg
atgacagggcagtttttctggacagagccggcaacgccgctgaccaaacatacgcgggtg
cggctgcggtttgagggcgatcgcgagttgcgatttattgatatccgcagctttggccag
atgtggtgggtaccgcccgatcgccctgtggaatccgtgattacgggcttgagcaaactg
gggccagaaccgtttgcaccggaattcaccgcccgctatctgcgcgatcgcctgcggcgg
agccaacgccccatcaaaacggcgctcctcgatcagtccttggtggcgggtattggcaac
atttatgccgatgaaagtttgtttcgcaccggtattcatccgaccacaccaagcgatcgc
ctaaccaagatccaggcggaaaaactgcgggaagcgatcgttgaggtcctcacggccagt
atcggagcaggcggcacgacctttagtgacttccgcgatctaacgggtgtgaacggtaac
tatggcggtcaagcgtgggtctatggccgcaaggatcaaccttgtcgcacttgcgggact
ccgattcaaaaactcaaactggctgggcgatcgagtcacttttgtcctcgctgtcagccc
tgttcctag

DBGET integrated database retrieval system