KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1352Help
Entry
Synpcc7942_1352   CDS       T00300                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:syf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syf00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:syf00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:syf00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:syf00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1383192..1385162
Genome map
AA seq 656 aa AA seqDB search
MSQPTIESILQEKRVFPPSAEFASAARINPEAYEALCQKAAADPVAFWGELAAQELDWFE
PWQQTLDWSNPPFAKWFVGGKLNISHNCLDRHLTTWRKNKAAIIWEGEPGDSRTLTYAQL
HREVCQFANVLKSLGIQKGDVVGVYMPMIPEAAIAMLACARIGAVHSVVFGGFSAEALRD
RLVDGQAKLVVTADGGWRKDAIVPLKDSVDQALEGNACPSVQHVLVVERTKQDIHMEPGR
DHWWHELQQTVSATCPAEPMDSEDLLFVLYTSGSTGKPKGVVHTTGGYNLYAHITTQWTF
DLQDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRASNPGCFWDVIEKYGVTT
FYTAPTAIRAFIKMGEQHPAARDLSSLRLLGTVGEPINPEAWIWYHRVIGGDRCPIVDTW
WQTETGGHMITSLPGAVPTKPGSATKPFPGILADVVDLDGRSVPDNEGGYLVIRHPWPGM
MRTVYGDPDRFRRTYWEHIPPQNGQYLYFAGDGARRDADGYFWVMGRVDDVINVSGHRLG
TMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFITLESGIETGDELVKDLKKHVAQEIG
AIARPDEIRFSEALPKTRSGKIMRRLLRSLAAGQEVSGDTSTLEDRSVLDKLRQGT
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccaacgatcgagtcgatcctccaagagaagcgggtttttcctccctcggca
gaatttgccagtgcggcgcgaatcaatcccgaagcgtacgaagcgctctgccagaaagcg
gcggccgatccggtggctttttggggcgaattggcagctcaggagctggactggtttgag
ccttggcaacagacgctggactggagcaatccgccgtttgcgaagtggtttgtcggtggc
aaactcaatatttcccacaactgcctcgatcgccacttgacgacttggcgcaaaaataaa
gcggcgattatctgggaaggcgaacccggtgactcacggacgctgacctacgcgcaactg
catcgcgaggtctgtcagttcgccaacgtgctcaaatccttgggcattcaaaaaggtgat
gtcgttggcgtttacatgccgatgattcccgaagcggcgatcgccatgctggcctgtgcg
cggattggcgcagtgcatagcgttgtctttgggggctttagtgcggaagcactgcgcgat
cgcttggtggatggccaagccaagctggttgtcacggcggatggtggctggcgcaaagat
gcgatcgtgcccctcaaggattctgttgatcaagccctggaaggcaatgcctgccccagc
gtccagcatgtcctcgtggtggaacggacgaagcaagacatccacatggaaccggggcgc
gaccattggtggcatgagctgcaacagaccgtcagcgctacctgtccggcggagccgatg
gacagcgaagatctgctcttcgtgctctacacctccggtagcaccggcaaacccaagggt
gtcgtccacaccaccggcggctacaacctctacgcccacatcaccacccagtggactttt
gacctgcaggataccgatgtctactggtgtacggcggacgtcggctggattaccggtcac
agctacatcgtctacgggccgctctccaacggtgcgaccacactgatgtatgagggtgcc
ccccgcgcttctaatcccggttgcttctgggatgtgattgaaaagtatggcgttacgacc
ttctacacagccccaacagcgatccgcgccttcatcaaaatgggtgagcagcatcccgcc
gctcgcgacctctcctcattgcgactgttgggcaccgtcggagagcccatcaatcccgaa
gcttggatctggtatcaccgcgtcattggtggcgatcgctgcccgattgtcgatacctgg
tggcagaccgaaacgggcggccatatgattacgtcgctgccgggagccgtgccgaccaaa
ccgggctctgccactaaacctttcccgggcatcttggcagacgttgtcgatctggatggg
cgatcggtgccggataacgaaggtggctacttggtgattcgccatccttggccaggcatg
atgcgcacggtctacggcgatcccgatcgcttccgtcgcacctattgggagcatattcct
ccgcaaaatggccagtatctctacttcgccggcgatggcgcgcgccgcgatgccgatggc
tatttctgggtgatggggcgcgtcgatgacgtgatcaatgtctcaggtcaccgtctcggc
acgatggaaattgagtcggccttggtctcccatccggcagttgccgaagctgcagttgtc
ggtcggcctgacgatctcaaaggtgaaggcattgttgctttcatcacgctggaatcgggc
attgagactggcgatgagttagttaaagacctgaagaaacacgtcgcccaagaaattggc
gcgatcgctcgtcccgatgaaattcgcttcagtgaggcgctgcccaaaacgcgatcgggc
aagattatgcgccgtctgttgcgcagtctcgccgctggtcaagaagtttcgggcgacact
tccaccttggaagatcgctcggtgctcgataagctgcgtcaaggcacttag

DBGET integrated database retrieval system