KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1352Help
Entry
Synpcc7942_1352   CDS       T00300                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Synpcc7942_1352
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_1352
   00620 Pyruvate metabolism
    Synpcc7942_1352
   00640 Propanoate metabolism
    Synpcc7942_1352
  Energy metabolism
   00680 Methane metabolism
    Synpcc7942_1352
Enzymes [BR:syf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Synpcc7942_1352
Lipid biosynthesis proteins [BR:syf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Synpcc7942_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1383192..1385162
Genome map
AA seq 656 aa AA seqDB search
MSQPTIESILQEKRVFPPSAEFASAARINPEAYEALCQKAAADPVAFWGELAAQELDWFE
PWQQTLDWSNPPFAKWFVGGKLNISHNCLDRHLTTWRKNKAAIIWEGEPGDSRTLTYAQL
HREVCQFANVLKSLGIQKGDVVGVYMPMIPEAAIAMLACARIGAVHSVVFGGFSAEALRD
RLVDGQAKLVVTADGGWRKDAIVPLKDSVDQALEGNACPSVQHVLVVERTKQDIHMEPGR
DHWWHELQQTVSATCPAEPMDSEDLLFVLYTSGSTGKPKGVVHTTGGYNLYAHITTQWTF
DLQDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRASNPGCFWDVIEKYGVTT
FYTAPTAIRAFIKMGEQHPAARDLSSLRLLGTVGEPINPEAWIWYHRVIGGDRCPIVDTW
WQTETGGHMITSLPGAVPTKPGSATKPFPGILADVVDLDGRSVPDNEGGYLVIRHPWPGM
MRTVYGDPDRFRRTYWEHIPPQNGQYLYFAGDGARRDADGYFWVMGRVDDVINVSGHRLG
TMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFITLESGIETGDELVKDLKKHVAQEIG
AIARPDEIRFSEALPKTRSGKIMRRLLRSLAAGQEVSGDTSTLEDRSVLDKLRQGT
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccaacgatcgagtcgatcctccaagagaagcgggtttttcctccctcggca
gaatttgccagtgcggcgcgaatcaatcccgaagcgtacgaagcgctctgccagaaagcg
gcggccgatccggtggctttttggggcgaattggcagctcaggagctggactggtttgag
ccttggcaacagacgctggactggagcaatccgccgtttgcgaagtggtttgtcggtggc
aaactcaatatttcccacaactgcctcgatcgccacttgacgacttggcgcaaaaataaa
gcggcgattatctgggaaggcgaacccggtgactcacggacgctgacctacgcgcaactg
catcgcgaggtctgtcagttcgccaacgtgctcaaatccttgggcattcaaaaaggtgat
gtcgttggcgtttacatgccgatgattcccgaagcggcgatcgccatgctggcctgtgcg
cggattggcgcagtgcatagcgttgtctttgggggctttagtgcggaagcactgcgcgat
cgcttggtggatggccaagccaagctggttgtcacggcggatggtggctggcgcaaagat
gcgatcgtgcccctcaaggattctgttgatcaagccctggaaggcaatgcctgccccagc
gtccagcatgtcctcgtggtggaacggacgaagcaagacatccacatggaaccggggcgc
gaccattggtggcatgagctgcaacagaccgtcagcgctacctgtccggcggagccgatg
gacagcgaagatctgctcttcgtgctctacacctccggtagcaccggcaaacccaagggt
gtcgtccacaccaccggcggctacaacctctacgcccacatcaccacccagtggactttt
gacctgcaggataccgatgtctactggtgtacggcggacgtcggctggattaccggtcac
agctacatcgtctacgggccgctctccaacggtgcgaccacactgatgtatgagggtgcc
ccccgcgcttctaatcccggttgcttctgggatgtgattgaaaagtatggcgttacgacc
ttctacacagccccaacagcgatccgcgccttcatcaaaatgggtgagcagcatcccgcc
gctcgcgacctctcctcattgcgactgttgggcaccgtcggagagcccatcaatcccgaa
gcttggatctggtatcaccgcgtcattggtggcgatcgctgcccgattgtcgatacctgg
tggcagaccgaaacgggcggccatatgattacgtcgctgccgggagccgtgccgaccaaa
ccgggctctgccactaaacctttcccgggcatcttggcagacgttgtcgatctggatggg
cgatcggtgccggataacgaaggtggctacttggtgattcgccatccttggccaggcatg
atgcgcacggtctacggcgatcccgatcgcttccgtcgcacctattgggagcatattcct
ccgcaaaatggccagtatctctacttcgccggcgatggcgcgcgccgcgatgccgatggc
tatttctgggtgatggggcgcgtcgatgacgtgatcaatgtctcaggtcaccgtctcggc
acgatggaaattgagtcggccttggtctcccatccggcagttgccgaagctgcagttgtc
ggtcggcctgacgatctcaaaggtgaaggcattgttgctttcatcacgctggaatcgggc
attgagactggcgatgagttagttaaagacctgaagaaacacgtcgcccaagaaattggc
gcgatcgctcgtcccgatgaaattcgcttcagtgaggcgctgcccaaaacgcgatcgggc
aagattatgcgccgtctgttgcgcagtctcgccgctggtcaagaagtttcgggcgacact
tccaccttggaagatcgctcggtgctcgataagctgcgtcaaggcacttag

DBGET integrated database retrieval system