KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1369Help
Entry
Synpcc7942_1369   CDS       T00300                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:syf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1407202..1407837
Genome map
AA seq 211 aa AA seqDB search
MGLRSKNCVNAIVSVYTRPLARLIEHLQKLPGVGPKTAQRLALHLIQRPEAEIAAFAEAL
LAAKQQVGHCQRCFHLSSEDLCNICRDPKRDAQTICVVADPRDVIALEKTREYKGLYHVL
GGLISPMDGIGPEQLTVQALVRRVAQEQTQEVIMAISPSVEGETTTLYVGQLLKPFTRVT
RIAFGLPMGGDLEYADEVTLARALEGRRDLT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttacgatcgaaaaattgcgtcaatgcgattgtgtctgtttatacccgtccgctg
gcccgcctgattgagcaccttcagaaactgccaggtgttggccccaaaacggctcaacgg
ttagcactgcacctcattcaacgacccgaagctgaaatcgcagcctttgcggaagcattg
ctagcagccaagcaacaagtggggcactgtcagcgctgttttcatctctcttcggaagac
ctctgcaacatctgccgagatcccaagcgcgacgcccaaaccatctgcgtggtggctgat
ccgcgcgacgtgatcgcccttgagaaaacccgcgaatataaggggctctatcacgtgctg
ggtgggttgatttcgcccatggatggcatcggtcctgagcagctaacggtgcaggcgctg
gtacggcgagtcgctcaggagcaaacgcaggaggtgattatggcgattagccccagcgtt
gagggcgaaacaacgacgctctatgtagggcagcttttgaaacccttcacccgtgtgacg
cgcattgcctttggtttaccgatggggggtgacttggagtacgccgatgaagtgacgctg
gctcgagcgctggagggtcgccgcgatctgacttag

DBGET integrated database retrieval system