KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1369Help
Entry
Synpcc7942_1369   CDS       T00300                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Synpcc7942_1369 (recR)
DNA repair and recombination proteins [BR:syf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Synpcc7942_1369 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1407202..1407837
Genome map
AA seq 211 aa AA seqDB search
MGLRSKNCVNAIVSVYTRPLARLIEHLQKLPGVGPKTAQRLALHLIQRPEAEIAAFAEAL
LAAKQQVGHCQRCFHLSSEDLCNICRDPKRDAQTICVVADPRDVIALEKTREYKGLYHVL
GGLISPMDGIGPEQLTVQALVRRVAQEQTQEVIMAISPSVEGETTTLYVGQLLKPFTRVT
RIAFGLPMGGDLEYADEVTLARALEGRRDLT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttacgatcgaaaaattgcgtcaatgcgattgtgtctgtttatacccgtccgctg
gcccgcctgattgagcaccttcagaaactgccaggtgttggccccaaaacggctcaacgg
ttagcactgcacctcattcaacgacccgaagctgaaatcgcagcctttgcggaagcattg
ctagcagccaagcaacaagtggggcactgtcagcgctgttttcatctctcttcggaagac
ctctgcaacatctgccgagatcccaagcgcgacgcccaaaccatctgcgtggtggctgat
ccgcgcgacgtgatcgcccttgagaaaacccgcgaatataaggggctctatcacgtgctg
ggtgggttgatttcgcccatggatggcatcggtcctgagcagctaacggtgcaggcgctg
gtacggcgagtcgctcaggagcaaacgcaggaggtgattatggcgattagccccagcgtt
gagggcgaaacaacgacgctctatgtagggcagcttttgaaacccttcacccgtgtgacg
cgcattgcctttggtttaccgatggggggtgacttggagtacgccgatgaagtgacgctg
gctcgagcgctggagggtcgccgcgatctgacttag

DBGET integrated database retrieval system