KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1519Help
Entry
Synpcc7942_1519   CDS       T00300                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00340  Histidine metabolism
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Synpcc7942_1519
Enzymes [BR:syf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Synpcc7942_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABB57549
JGI: Syn_pcc79421519
CyanoBase: Synpcc7942_1519
CYORF: Synpcc7942_1519
UniProt: Q31N20
Position
complement(1570976..1572280)
Genome map
AA seq 434 aa AA seqDB search
MLRIVSHLAEAQAELERICDRTHDDAVVHREASVREIVQAVQRRGDAALIEFTQEFDGFA
LQAENLRVSGAELDAAYQQIPKELLDAIRLAHHQIEAFHRQRVPKSWVQFGADGEVLGKR
YTPVDRAGLYVPGGRAAYPSTVLMNAVPAKVAGVERVVITTPPGPDGSLNPAVLVAAQEA
GIEEIYRVGGAQAIAALAYGTATIPKVDVISGPGNIYVTLAKKLVYGTVGIDSLAGPSEV
LIIADRSANPRWVAADLLAQAEHDPLAAAILITPDLELATQVGFEVERQLQDHPRRLVTE
KAIAHYGLAIVVDSLETAVKLSNQFAPEHLELEVEDPWALVEQVRHAGAIFLGSLTPEAI
GDYVAGPNHTLPTSGAARYASALSVETFLKSSSLIEYTAASLQRVARAVDVLATAEGLES
HAESVRLRQQSLDR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaattgtttctcacctcgctgaagctcaggcagaacttgagcgcatctgcgat
cgcacccatgatgatgccgtcgtccatcgcgaagcgagcgtccgggaaattgtccaagcg
gtccagcgacgcggcgatgccgctctgattgaattcacccaagaatttgatggttttgca
ctgcaggccgagaacctgcgagtcagtggcgcagagctagatgcggcctatcagcagatc
ccgaaggagctcctcgacgcgattcgtcttgcccaccatcaaattgaagcctttcaccgc
cagcgggtgcccaaaagctgggtgcagtttggcgctgatggcgaagtcctcggcaagcgc
tacacccccgtcgatcgcgctggtctctacgtcccgggggggcgcgctgcttatcccagc
actgtgctgatgaatgcggttcccgccaaggttgcaggggtcgaacgggttgtgatcacc
acgccgccaggacctgatggcagcttgaatccggccgtgttggtggctgcacaagaggcg
ggcattgaagagatttaccgagtcggtggagcccaggcgatcgcagccttggcctacggc
accgcaacgattcccaaagtcgacgtgatcagcggccccggcaacatctatgtgacgctg
gctaagaaactggtttacggcaccgtcgggatcgattccctagccggaccatctgaggtg
ttgatcattgccgatcgcagtgctaatccgcgctgggtagcagctgatctcttggcgcag
gccgaacatgatccgctcgccgcagcaattctgattacgcccgatctggagctagcgacg
caggtcggctttgaagttgagcggcagctgcaggatcatccgcgccgattggtcaccgaa
aaagcgatcgcccactacggccttgcgattgtggtggactcgctggagacagcggtcaaa
ctctcgaatcagtttgcgcccgagcacctggaactggaagtcgaagatccatgggccctg
gtggagcaggttcgccatgcgggggcgatcttccttggttctctaacaccagaagcgatc
ggcgactatgtggcggggcccaaccacaccctgccaacctccggggccgctcgttatgcc
tcagccctgagtgtggaaaccttcctcaagtcctccagcctgattgagtacacagcggct
tccttgcaacgggtggcacgagcggtggatgtgctggcgacggcggagggtctggaatcc
cacgccgaatcggtgcggctgcgccagcaatctttggatcgctag

DBGET integrated database retrieval system