KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1742Help
Entry
Synpcc7942_1742   CDS       T00300                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.13)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Synpcc7942_1742
   01230 Biosynthesis of amino acids
    Synpcc7942_1742
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_1742
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Synpcc7942_1742
Enzymes [BR:syf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Synpcc7942_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
1812814..1813833
Genome map
AA seq 339 aa AA seqDB search
MTIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYDSVLGRFNADI
SYDENSITVNGKTMKIVCDRNPLNLPWKEWDIDLVIESTGVFVTAEGASKHIQAGAKKVL
ITAPGKGEGVGTYVIGVNDSEYRHEDFAVISNASCTTNCLAPVAKVLHDNFGIIKGTMTT
THSYTLDQRILDASHRDLRRARAAAVNIVPTTTGAAKAVALVIPELKGKLNGIALRVPTP
NVSVVDLVVQVEKPTITEQVNEVLQKASQTTMKGIIKYSDLPLVSSDFRGTDESSIVDSS
LTLVMDGDLVKVIAWYDNEWGYSQRVVDLAELAARKWAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattcgagttgcgatcaatggctttggccgtattggccggaattttctccgttgc
tggtttggacggcagaacaccgatctagaggttgtggccattaacaacacctcggatgca
cggacggctgctcacctgctggagtacgactctgttctcggccggttcaacgccgacatc
agctacgacgaaaattcgatcaccgtcaacggcaagacgatgaaaatcgtctgcgatcgc
aaccccctcaacctgccttggaaagagtgggatatcgatctcgtcattgaatctacaggt
gtgttcgtcaccgctgaaggcgcatccaagcacatccaagccggggccaagaaagttctg
atcacggctcctggtaaaggcgaaggtgtcggcacctacgtcatcggtgtcaacgattcg
gaataccgccacgaagacttcgcagtcatcagcaatgcaagctgcaccaccaactgctta
gcaccggtcgccaaagttctgcatgacaactttggcatcatcaaaggcacgatgaccacc
acccacagctacacgctggaccagcgcatcttggacgccagccaccgtgatctacgtcgg
gctcgggctgcagccgttaacatcgttcccaccacgaccggcgctgctaaagccgttgct
ttggtgatccccgagctgaaaggcaaactaaacgggattgcgctgcgcgttcctacgcca
aacgtgtctgtcgttgacttggtggttcaagtcgagaaaccgacgatcactgagcaggtc
aatgaagtcctgcaaaaagcttctcaaacgacgatgaagggcatcatcaagtactcggat
ctgcccttggtctcttccgacttccggggtactgacgagtcttcgatcgttgactccagc
ctgaccttggtaatggatggcgatctcgtcaaagtaattgcttggtacgacaacgagtgg
ggctacagccaacgagttgtcgacttggctgaactggccgctcgcaaatgggccgcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system