KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1782Help
Entry
Synpcc7942_1782   CDS       T00300                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Synpcc7942_1782
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Synpcc7942_1782
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Synpcc7942_1782
Enzymes [BR:syf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Synpcc7942_1782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1847829..1849121)
Genome map
AA seq 430 aa AA seqDB search
MTQTTLSTSTVKALKCKECGHEYDLGAKHVCEDVCFGPLEVVYDYDAIRQRVSRATIEAG
PNSIWRYRHFLPVTGEDVIDVGTGMTPLVEAKRLARRLGLKKLFIKNDAVNMPTLSFKDR
VVSVALTRARELGFSTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTLIYN
PTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVAEQLGWQLPDHI
VAPLASGSLFTKIYKGFREFVDVGLVDDKAVRFSGAQAEGCSPIAKAFHEGRDFIAPEKP
NTIAKSIAIGNPADGIYAVEIARKTGGNIEAVNDTEIIEGIKLLAETEGIFTETAGGTTV
AVLKKLVEAGKINPDETTVVYITGNGLKTQEAVQGYIAEPFTIEPKLESFEHALERSRTL
DRLEWQQVLI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaacgacactcagcaccagcaccgtgaaggcactcaagtgtaaagagtgcggt
catgagtatgacctgggtgccaagcacgtttgtgaagatgtctgtttcggcccgctggaa
gtggtctatgactacgacgccattcgccaacgcgtcagtcgcgccaccattgaagcgggc
cctaactcaatttggcgctatcgtcacttcctgcctgttactggcgaagacgtcattgac
gttggcaccggcatgacccctttggttgaagccaaacgcttggctcgccgcttgggtctg
aaaaagcttttcatcaaaaacgatgcggtcaacatgccgaccttgagcttcaaggatcgg
gtcgtttccgtggcgctgacccgtgcgcgtgagcttggcttcagcactgtttcctgcgct
agcaccggcaacctcgctaactcaacggccgcgatcgcggctcatgccggtctggactgc
tgcgtcttcattcctgctgatctggaagccggtaaagtcctcggcaccttgatctataac
ccgaccttgatggcggtcaaaggcaactacgaccaagtcaaccgcctctgctccgaagtc
gctaacacccacggctggggcttcgtcaacatcaacctgcgcccctactactcggaaggc
tcgaaaacgctgggctacgaagtggctgagcaactgggctggcaactgccggatcacatt
gtggcgccgctggcttcgggctcgctgttcaccaaaatctacaaaggcttccgcgaattc
gtcgatgtcggtcttgtcgatgacaaagccgtgcgcttcagcggtgctcaagccgaaggt
tgctcgccgatcgccaaagctttccatgaaggtcgcgactttatcgcccctgaaaaaccc
aacacgatcgctaaatcgatcgcgatcggcaaccctgctgacggcatctatgcggttgaa
attgctcgcaaaaccggcggcaacatcgaagcagtcaatgacaccgagatcatcgaaggc
atcaagctactggccgagaccgaaggcatctttaccgaaactgctggcggtaccaccgtc
gctgtgctcaagaaattggtggaagcaggcaaaatcaatcctgatgaaaccacggtggtc
tacatcaccggcaacggtctgaagacccaagaagccgttcagggctacattgctgagccg
ttcacgattgagccgaaactggaaagcttcgagcatgcgctagagcgctctcggaccctc
gatcgcttggaatggcagcaagtgctgatctag

DBGET integrated database retrieval system