KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2029Help
Entry
Synpcc7942_2029   CDS       T00300                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_2029
   00030 Pentose phosphate pathway
    Synpcc7942_2029
   00500 Starch and sucrose metabolism
    Synpcc7942_2029
   00520 Amino sugar and nucleotide sugar metabolism
    Synpcc7942_2029
Enzymes [BR:syf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Synpcc7942_2029
Exosome [BR:syf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Synpcc7942_2029
  Exosomal proteins of other body fluids (saliva and urine)
   Synpcc7942_2029
  Exosomal proteins of colorectal cancer cells
   Synpcc7942_2029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2097799..2099385
Genome map
AA seq 528 aa AA seqDB search
MTAQQLWQRYLDWLYYDPSLEFYLDISRMGFDDAFVTSMQPKFQHAFAAMAELEAGAIAN
PDEQRMVGHYWLRDPELAPTPELQTQIRDTLAAIQDFALKVHSGVLRPPTGSRFTDILSI
GIGGSALGPQFVSEALRPQAALLQIHFFDNTDPAGFDRVLADLGDRLASTLVIVISKSGG
TPETRNGMLEVQSAFAQRGIAFAPQAVAVTGVGSHLDHVAITERWLARFPMEDWVGGRTS
ELSAVGLLSAALLGIDITAMLAGARQMDALTRHSDLRQNPAALLALSWYWAGNGQGKKDM
VILPYKDSLLLFSRYLQQLIMESLGKERDLLGKVVHQGIAVYGNKGSTDQHAYVQQLREG
IPNFFATFIEVLEDRQGPSPVVEPGITSGDYLSGLLQGTRAALYENGRESITITVPRVDA
QQVGALIALYERAVGLYASLVGINAYHQPGVEAGKKAAAGVLEIQRQIVELLQQGQPLSI
AAIADDLGQSEQIETIYKILRHLEANQRGVQLTGDRHNPLSLIASWQR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagcagctctggcaacgctacctcgattggctctactacgatccctcgctg
gagttttacctcgacatcagccgcatgggattcgatgacgctttcgttactagcatgcag
cccaagttccagcacgcctttgcggcgatggcagagctcgaggccggagcgatcgccaac
cccgatgaacagcggatggtcggccactactggctgcgcgatcctgagctggcacccaca
ccggagctgcagacccaaattcgcgacacgctggccgcgatccaagacttcgccctcaaa
gtacacagtggcgtgttgcggccacccaccggctcccgcttcaccgacattctctcaatt
ggcattggcgggtcggccctagggccgcagtttgtctcagaagccctccggcctcaagcg
gcactgctccagattcacttctttgacaacaccgatccagctggcttcgatcgcgtttta
gctgatctcggcgatcgccttgcttccaccttagtaatcgttatttccaaatctggcggc
actcccgaaacccgcaacggcatgctggaggttcagtccgcctttgcccagcgagggatt
gcctttgcgccccaagctgtcgccgtcacaggggtggggagccatctcgatcatgtagcg
atcacagaaagatggctggcccgtttccccatggaagactgggtgggcggccgcacctct
gaactatctgcagtcggtctactctcggcagccctactgggcatcgacatcaccgccatg
ctggccggggcgcggcaaatggacgccctgacccgccattccgatttgcgacaaaatccg
gcagcgctcttggctttgagctggtactgggccggcaatgggcaaggcaaaaaagacatg
gtcatcctgccctacaaggacagcctgctgctgtttagccgctatctgcagcagttgatc
atggagtcactgggcaaggagcgcgatctgctcggcaaggtagttcaccaaggcatcgcc
gtttacggcaacaaaggctcgaccgatcaacatgcctacgtccagcaactgcgcgagggc
attcctaacttctttgccacgtttatcgaggtgctcgaagaccgacaggggccgtcgcca
gtcgtggagcctggcatcaccagtggcgactatctcagcgggctgcttcaaggcacccgc
gcggcgctttacgaaaatgggcgtgagtcgatcacgattacggtgccgcgcgttgatgca
caacaggtgggggccttgatcgcgctgtatgaacgggcggtgggactctatgccagcttg
gttggcatcaatgcctatcaccagccgggggtggaagccggcaaaaaggctgctgccggt
gttctcgagatccagcgccagattgtggagttgctccaacagggacaaccactctcgatc
gcagcgatcgcagacgatttaggtcagagtgagcagattgaaacgatctacaaaatcctg
cgccatctcgaagccaatcaacgcggcgttcagttaaccggcgatcgccataatcccctc
agtctgattgcgagttggcaacgataa

DBGET integrated database retrieval system