KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2111Help
Entry
Synpcc7942_2111   CDS       T00300                                 

Definition
xylose repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Synpcc7942_2111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_2111
   00052 Galactose metabolism
    Synpcc7942_2111
   00500 Starch and sucrose metabolism
    Synpcc7942_2111
   00520 Amino sugar and nucleotide sugar metabolism
    Synpcc7942_2111
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Synpcc7942_2111
   00524 Butirosin and neomycin biosynthesis
    Synpcc7942_2111
Enzymes [BR:syf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Synpcc7942_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2192025..2192933
Genome map
AA seq 302 aa AA seqDB search
MAYPATVIGVDLGGTAMKLGRYTIEGQCQQELTVPTPTPSTPSNVRAALVEAIRQLDPQA
EALAIGIGTPGPADAAGRVARVAINLDGWTEVPLADWLEADLQRPVILANDANCAGLGEV
WLGGGRGYRDAILLTLGTGVGGAIVLNGELFVGRTGTAAELGLITLDPAGPHCNSGNQGS
LEQYASIGAVQRRFGCDPKDLGDRASQGDPEAIAAWQDYGRTLAAGLASLVYVLTPEVII
LGGGISGSAAFFLPALTEELHRRVLPTSREDLQIAIAALGNEAGRVGAAKLAWDKLQALG
KV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcataccccgcgaccgtgatcggcgtcgatttgggcggaactgccatgaaattgggg
cgttacacgattgagggacagtgtcagcaggaattgaccgtcccaactccaacccccagc
acgccaagcaatgttcgggctgcgctcgtagaggcgatccgtcagctcgatccccaagct
gaagcactggcgatcggcattggtacaccggggcctgcggatgcagccggtcgggtagcg
cgggttgccatcaatctggacggctggactgaggtccccctggctgactggctggaagcc
gatctgcaacggccggtcattttggccaatgatgccaactgcgctggcttgggtgaagtc
tggctgggtggcggtcggggctatcgcgatgccattttgctgactctcgggaccggcgtg
ggcggggcgatcgtactcaatggcgagctgtttgtgggtcgcacgggaacagcagcagaa
ctcgggctgatcacactggacccggctgggccgcattgcaatagtggcaaccaaggatcg
ttagagcaatatgcctcgatcggagccgttcagcggcgctttggttgcgatcccaaagac
ctcggcgatcgcgcttcccaaggggatcctgaagcgatcgcggcttggcaggactatggc
cgaacgctcgctgccggtcttgccagtctggtctatgtcctgacgcccgaagtgattatt
ctgggcggcggcatcagcggcagtgcagctttcttcttaccggcactgacggaggagctg
catcgtcgcgtcctcccgacctctcgtgaagatctgcagattgcgatcgcggcactcggc
aacgaagccggtcgagttggggctgccaagttggcttgggacaagctacaagcactgggc
aaggtctga

DBGET integrated database retrieval system