KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2137Help
Entry
Synpcc7942_2137   CDS       T00300                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Synpcc7942_2137
Enzymes [BR:syf01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Synpcc7942_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2216577..2220563
Genome map
AA seq 1328 aa AA seqDB search
MFTQVKSAIRRIVPEDLNGRSRLKVVYVVLEAQYQSALSAAVRSINAGSHQVAVELSGYL
IEELRDPENYDAFKADLQDADIFIGSLIFIEDLAEKVVSAVQPVRDRLAASIVFPSMPEV
MRLNKLGSFSMAQLGQSKSVIASFMKKRKEAGGAGFQDAMLKLLRTLPNVLKYLPVEKAQ
DARNFMLSFQYWLGGSPENLENFLLMIADRYVFKKDSDVNVNFEEPVVYPDQGIWHPLAP
QMFEDLKEYLNWYQSRQDLPKQDGPTIGLVLQRSHLVTGDDAHYVAVVSEMEYRGAKVIP
VFNGGLDFSKPVQQYFFDPLDPETPIIDATVSLTGFALVGGPARQDHPKAIETLKKLNRP
YMVALPLVFQTTEEWEESDLGLHPVQVALQIAIPELDGAIEPIIMSGRDSATGKAHTLQD
RVEMIAERSIRWANLRRTPRATKKLAITVFSFPPDKGNVGTAAYLDVFGSIHRVMEELKA
AGYTVEGMPKTAKELMEEVIHDAQAQYASPELNIAYRMSVSEYQRLTPYAERLEENWGPP
PGQLNSDGENLLIFGKQFGNVFIGVQPTFGYEGDPMMLLYSRSASPHHGFAAYYTYLNHI
WGANAVLHFGTHGSLEFMPGKQMGMSGACYPDNLIGTIPNLYYYAANNPSEATIAKRRGY
AETISYLTPPAENAGLYKGLKELSELVGSYQTLRESGRGVAICNSIVETCRQVNLDQDVE
LPDVDAAELSADDRDRLVGNVYRKLMEIESRLLPCGLHVIGKPPTAEEAIATLVNIASLD
RDEEGITGLPTLIARSLGREMEEIFRSADLGVLDDVNLNQSITEAVRASVAAMVREVTGS
DGRVSLVKRFGWIEKLLAFFNIKLKPAYQRALEAKGYKVDEDALKVLFDYLQFCLEQVCA
DLEMQNLVKALDGEYVMPAPGGDPIRNPNVLPSGRNIHALDPQSIPTTAAVQSAKVVVDR
LLDRQRAENDGNWPETIACVLWGTDNIKTYGESLAQILWFVGVKPKPDSLGRVNKLELIP
LEELGRPRVDVVVNCSGVFRDLFINQMALIDQAVKMAAEADEPLEMNFVRKHSLEQAKKL
NIELRQAASRVFSNASGSYSSNVNLAIENSSWEEESELQNMYLERKSFAFDSDNPGMMNQ
NQELFRESLKTADVTFQNLDSSEISLTDVSHYFDSDPTKLVASLREDGKKPASFIADTTT
ANAQVRTLNETVRLDSRTKLLNPKWYEGMLNSGYEGVREIAKRLNYTSGWSATAGAVDNW
VYEEANTTFISDPEMQKRLMDLNPHSFRRMVGTLLEVAGRGYWETSDENIQRLQELYQEV
EDRIEGVE
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atgttcacccaggtcaagtccgcaatccgtcgcatcgtgcccgaggaccttaacgggcga
tcgcggctgaaagtggtctacgtcgtcttggaagcgcagtatcagagtgcgctctcggcc
gccgtccgatcgatcaatgctggctcccatcaagttgctgttgaactgagcggctacctg
atcgaagaactgcgcgatcccgaaaactacgacgcctttaaagccgatctgcaggatgca
gatatcttcatcggctcgctgatcttcatcgaagacctagctgagaaagtggtcagcgcc
gtgcaaccggtgcgcgatcgccttgccgcctcgatcgtcttcccctcgatgccggaggtg
atgcgcctcaacaagctcggctccttctcgatggcgcagctgggccaaagcaagagcgtg
atcgccagcttcatgaagaagcgcaaggaagcgggtggagcaggtttccaagacgccatg
ctcaagctgctgcgtaccctgccgaacgtcctcaagtacctgccggttgagaaggcacag
gacgctcgcaacttcatgcttagcttccagtactggctggggggttcgccagagaacctg
gaaaacttcctgttgatgattgccgatcgctacgtcttcaaaaaagacagcgacgtcaac
gtcaactttgaagagccagtcgtttaccccgaccaaggcatctggcacccgctggcaccc
cagatgtttgaggacttgaaggagtacctcaactggtatcagtcgcgccaagacctgccc
aagcaagatggtccaaccatcggcctggtgctgcagcgcagccacttggtcaccggcgac
gatgcgcactacgtggcggtcgtttccgagatggaatatcgcggtgccaaagtgattccc
gtcttcaacggcgggctggacttttcgaagccggtgcagcagtacttcttcgatcccctc
gatcccgagacaccgatcatcgacgcaaccgtctcgctgaccggctttgcgctggtgggt
ggccctgcgcgccaagaccatcccaaggcgatcgaaaccctcaaaaagctgaatcgtccc
tacatggtggcgctgccgctggtcttccaaaccacggaagagtgggaagagagcgacctc
ggtttgcaccccgtgcaagtggcgctgcaaatcgccattcctgagctagacggcgcgatc
gagccgatcattatgtctggccgcgatagcgccaccggcaaagcccacaccctgcaagat
cgggtcgagatgatcgcagagcgatcgatccgctgggccaacctgcgccgcacgcctcgc
gccactaaaaagctggcgatcaccgtcttcagcttcccgccggataagggcaacgttggt
acggcggcctatctggacgtgttcggctcgatccatcgcgtcatggaagagctgaaagcg
gcaggctacaccgtggaagggatgccgaagaccgccaaggagttgatggaggaagtcatc
cacgacgcccaagcccaatacgcctcgccggaactgaacatcgcctaccgcatgtcggtg
agcgaataccagcggctgacgccctacgcggaacgcctcgaagaaaactgggggccacct
ccgggacagctgaacagcgacggcgaaaacctgctgatcttcggtaagcagtttggcaac
gtcttcatcggcgtccagccgaccttcggttacgaaggcgacccgatgatgctgctctac
agccggagcgctagccctcaccacggctttgctgcctattacacctacctcaaccacatt
tggggggcgaacgcggtgctgcacttcggcacccacggctcgctggagttcatgcctggt
aagcagatgggcatgagcggtgcctgctaccccgacaacttgatcggcacgatccccaac
ctctactactacgcggcgaacaacccctcagaagccacgatcgccaaacgacggggctat
gccgaaacgatcagctacctgaccccacccgctgaaaacgcgggtctctacaagggtctg
aaggaactgagcgagctggtgggcagctaccaaaccctgcgggaaagtggccgcggtgtc
gccatctgcaactcgattgtggaaacctgccgtcaggtcaacctcgaccaagacgtcgaa
ctaccggacgttgatgccgcagaactgagcgccgacgatcgcgatcgcctagtgggcaac
gtctaccgcaagctgatggaaatcgagagccgtctgctgccctgcggtctgcacgtgatt
ggcaaaccgccaactgccgaagaagcgatcgccaccctcgtcaacatcgccagcctcgat
cgcgatgaagaagggatcaccggcctaccgaccttgattgcccgcagcctcggtcgcgag
atggaagaaatcttccgcagcgctgatctgggcgtgctggatgacgtcaacctcaaccag
tcgatcaccgaagcggttcgtgcttcagtggcagcgatggtgcgggaagtcaccggcagt
gatggccgtgtctcgctggtcaaacgctttggctggatcgaaaagctgctggctttcttc
aacatcaaactgaaaccggcctaccaacgggctttggaagccaagggctacaaggttgat
gaggatgcgctgaaagtcctgttcgactatctgcaattctgcttggagcaagtctgcgcc
gacttggaaatgcagaacctcgtcaaggcgctggacggcgaatatgtgatgcccgcgccg
ggtggcgacccgattcgtaaccccaacgtgctgccgtccggtcgcaacattcacgcgctg
gatccccagtcgattccgacgaccgcagcggtgcaatcggccaaagtcgtggtcgatcgc
ctgctcgatcgccagcgggcagaaaatgacggcaactggccagaaacaatcgcctgcgtt
ctctggggcaccgacaacatcaagacctacggcgagtcgctggcgcaaatcctctggttt
gtcggcgtcaagccgaagccggacagcctcggtcgcgtcaacaagctggagctgattccg
ctggaagagctgggtcgtccccgcgtcgatgtggtcgtcaactgttcgggcgtgttccgc
gatctgttcatcaaccaaatggcgctgatcgaccaagcggtgaaaatggctgccgaagct
gatgagccgctggagatgaactttgtgcgcaagcactcgctggagcaagccaagaagctg
aacattgagctgcgccaagcggcaagccgtgtcttctccaacgcttccggtagctacagc
agcaacgtcaacttggcgatcgagaacagcagctgggaagaggaaagcgaactccagaac
atgtatctggagcgtaaatccttcgcgtttgatagcgacaaccccggcatgatgaaccaa
aatcaggaactgttccgggaatcgctgaagacagcggatgttaccttccagaacttggat
tcgtcggaaatttcgctgacggatgtgagccactacttcgacagcgacccgaccaagttg
gtggcgagcctgcgggaagacggcaagaaaccggcgagcttcattgccgacacgaccacg
gcgaatgcccaagtgcggacgctaaatgaaacggtgcggctggactcgcggacgaagctg
ctcaatcccaagtggtacgaagggatgctgaacagcggttatgaaggcgtgcgggaaatt
gctaagcgcttgaactacacttcgggctggtcagcgacggcgggcgcggttgataactgg
gtctatgaggaggcgaatacgaccttcatttctgatccggaaatgcagaagcgcctgatg
gatctcaacccccacagcttccgccgcatggtgggcacgctactagaggttgcaggtcgc
ggctactgggaaaccagtgacgaaaatatccaacgcctgcaagagctctatcaagaggtc
gaagaccgaatcgaaggcgtcgaataa

DBGET integrated database retrieval system