KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2272Help
Entry
Synpcc7942_2272   CDS       T00300                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00790  Folate biosynthesis
syf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Synpcc7942_2272
Enzymes [BR:syf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Synpcc7942_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ABB58302
JGI: Syn_pcc79422272
CyanoBase: Synpcc7942_2272
CYORF: Synpcc7942_2272
UniProt: Q31KW7
Position
complement(2339596..2340126)
Genome map
AA seq 176 aa AA seqDB search
MAILERTDWTAIAVALGSNLGNRVKHLQQAIAQLAALSSIRRLQVSPVYQTPPVGPPQPD
YYNACAIAETCLAPHDLLQQLQAIEAAAGRERLQHWGPRTLDLDLLLYGDRQIQTPDLTV
PHPYLTQRAFVLIPLAAIAPDWVEPVTGEAIATLAQRLDSTGIERLGSMEALAESP
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtggccattctagaaaggactgattggaccgccattgcagttgccctcggcagtaacttg
gggaaccgtgtcaagcaccttcagcaggcgatcgctcagcttgcagccttatctagcatt
cgccggctacaagtctcgccggtctaccaaacaccgccagttggccctccgcaaccggat
tactacaatgcttgcgcgatcgcagaaacctgtctggcaccacacgatctgttgcaacaa
ctgcaggcgatcgaagcggcggcaggacgggaacggttgcaacattgggggccgcgcaca
ttggacctcgatctgctgctctatggcgatcgccagattcaaacgcccgacttgacggtg
ccgcatccttacctgacccagcgagcttttgtcctgatccccctggctgcgatcgctcca
gattgggttgaacccgtcactggagaagcgatcgcgaccttggcgcaacggctggactca
actggaatcgagcgactcggtagcatggaagcgttggccgagagcccctaa

DBGET integrated database retrieval system